KEGG   Mus pahari (shrew mouse): 110324307
Entry
110324307         CDS       T05929                                 

Gene name
Sav1
Definition
(RefSeq) protein salvador homolog 1
  KO
K16686  scaffold protein salvador
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
mpah04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110324307 (Sav1)
   04392 Hippo signaling pathway - multiple species
    110324307 (Sav1)
SSDB
Motif
Pfam: WW
Other DBs
NCBI-GeneID: 110324307
NCBI-ProteinID: XP_021057414
Ensembl: MGP_PahariEiJ_G0029571
LinkDB
Position
7
AA seq 386 aa
MLSRKKTKNEVSKPAEVQGKYVKKETSPLLRNLMPSFIRHGPTIPRRTDLCLPDPSAGAF
SASGDGVVSRNQSFLRTPVQRTPHEVMRRESNRLSAPSYLVRSLADVPRECGSSQSFLTE
VNFAVENGDSGSRYFYSDSFFDGQRRRPLGDRAQEDYRYYEYNHDLFQRTPQNQGRHTSG
IGRVTATSLGNLTNHGSEDLPLPPGWSVDWTMRGRKYYIDHNTNTTHWSHPLEREGLPPG
WERVESSEFGTYYVDHTNKRAQYRHPCAPSVPRYDQPPPITYQPQQTERNQSLLVPANPY
HTAEIPDWLQVYARAPVKYDHILKWELFQLADLDTYQGMLKLLFMKELEQIVKLYEAYRQ
ALLTELETRKQRQQWYAQQHGRKFLS
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgctgtcccgcaagaaaaccaaaaacgaggtgtctaagccggccgaggtgcagggcaag
tacgtgaagaaggagacgtcgcccctgctgcggaatctcatgccttcattcattcggcac
ggcccaacgattcccaggcggactgacctctgtctcccagatccgagtgccggtgctttc
tcagcgtctggagatggcgtagtttcaagaaaccagagttttctgagaactccagttcaa
aggacgcctcatgaagtaatgaggagagaaagcaacagactgtcagcgccttcctacctt
gtcaggagcctagcggatgtccctcgagagtgtggctcgtcacagtcatttttgacagaa
gttaattttgctgttgagaatggagactctggctcccgatacttctattcagatagcttt
tttgatggtcagagaaggcggccacttggagatcgtgcacaagaagactacagatattat
gagtacaaccatgatctcttccaaagaacgccacagaatcaggggaggcacacttcaggt
attgggagagtcactgctacatctttagggaatttaactaaccatggatctgaagattta
ccccttcctcctggctggtctgtggactggacaatgagagggaggaagtactacatagat
cataacacaaacacaactcattggagtcatcctcttgaacgagaaggacttcctcctggg
tgggaacgagtggagtcatcagaatttggaacctattatgtggatcacaccaataaaagg
gctcagtacaggcacccctgtgctcccagtgtacctcggtatgatcagcctccacccatc
acgtatcagccacagcaaactgaaagaaatcagtctctcctggtccctgcaaatccctac
catactgcagaaattcctgactggcttcaggtttatgcccgagcccctgtgaaatatgac
cacattctgaagtgggagctcttccagctggctgacctggacacgtaccagggaatgctg
aagctgctcttcatgaaggaactggagcagattgtgaagttgtacgaggcctacagacag
gctcttctcactgagttggaaacccgcaagcagagacagcagtggtatgcccagcagcat
ggcaggaagtttttaagctaa

DBGET integrated database retrieval system