KEGG   Mus pahari (shrew mouse): 110324314
Entry
110324314         CDS       T05929                                 

Gene name
Sos2
Definition
(RefSeq) son of sevenless homolog 2 isoform X1
  KO
K03099  son of sevenless
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04062  Chemokine signaling pathway
mpah04068  FoxO signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04510  Focal adhesion
mpah04540  Gap junction
mpah04630  JAK-STAT signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04660  T cell receptor signaling pathway
mpah04662  B cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04714  Thermogenesis
mpah04722  Neurotrophin signaling pathway
mpah04810  Regulation of actin cytoskeleton
mpah04910  Insulin signaling pathway
mpah04912  GnRH signaling pathway
mpah04915  Estrogen signaling pathway
mpah04917  Prolactin signaling pathway
mpah04926  Relaxin signaling pathway
mpah04935  Growth hormone synthesis, secretion and action
mpah05034  Alcoholism
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05210  Colorectal cancer
mpah05211  Renal cell carcinoma
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05220  Chronic myeloid leukemia
mpah05221  Acute myeloid leukemia
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110324314 (Sos2)
   04012 ErbB signaling pathway
    110324314 (Sos2)
   04014 Ras signaling pathway
    110324314 (Sos2)
   04630 JAK-STAT signaling pathway
    110324314 (Sos2)
   04068 FoxO signaling pathway
    110324314 (Sos2)
   04072 Phospholipase D signaling pathway
    110324314 (Sos2)
   04151 PI3K-Akt signaling pathway
    110324314 (Sos2)
   04150 mTOR signaling pathway
    110324314 (Sos2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110324314 (Sos2)
   04540 Gap junction
    110324314 (Sos2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110324314 (Sos2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110324314 (Sos2)
   04660 T cell receptor signaling pathway
    110324314 (Sos2)
   04662 B cell receptor signaling pathway
    110324314 (Sos2)
   04664 Fc epsilon RI signaling pathway
    110324314 (Sos2)
   04062 Chemokine signaling pathway
    110324314 (Sos2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110324314 (Sos2)
   04912 GnRH signaling pathway
    110324314 (Sos2)
   04915 Estrogen signaling pathway
    110324314 (Sos2)
   04917 Prolactin signaling pathway
    110324314 (Sos2)
   04926 Relaxin signaling pathway
    110324314 (Sos2)
   04935 Growth hormone synthesis, secretion and action
    110324314 (Sos2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110324314 (Sos2)
  09159 Environmental adaptation
   04714 Thermogenesis
    110324314 (Sos2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110324314 (Sos2)
   05206 MicroRNAs in cancer
    110324314 (Sos2)
   05205 Proteoglycans in cancer
    110324314 (Sos2)
   05231 Choline metabolism in cancer
    110324314 (Sos2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110324314 (Sos2)
   05225 Hepatocellular carcinoma
    110324314 (Sos2)
   05226 Gastric cancer
    110324314 (Sos2)
   05214 Glioma
    110324314 (Sos2)
   05221 Acute myeloid leukemia
    110324314 (Sos2)
   05220 Chronic myeloid leukemia
    110324314 (Sos2)
   05211 Renal cell carcinoma
    110324314 (Sos2)
   05215 Prostate cancer
    110324314 (Sos2)
   05213 Endometrial cancer
    110324314 (Sos2)
   05224 Breast cancer
    110324314 (Sos2)
   05223 Non-small cell lung cancer
    110324314 (Sos2)
  09165 Substance dependence
   05034 Alcoholism
    110324314 (Sos2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110324314 (Sos2)
   05160 Hepatitis C
    110324314 (Sos2)
   05163 Human cytomegalovirus infection
    110324314 (Sos2)
   05165 Human papillomavirus infection
    110324314 (Sos2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110324314 (Sos2)
   01522 Endocrine resistance
    110324314 (Sos2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mpah04990]
    110324314 (Sos2)
Domain-containing proteins not elsewhere classified [BR:mpah04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   110324314 (Sos2)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH IQ_SEC7_PH PH_19
Other DBs
NCBI-GeneID: 110324314
NCBI-ProteinID: XP_021057426
Ensembl: MGP_PahariEiJ_G0029564
LinkDB
Position
7
AA seq 1333 aa
MQQAPQPYEFFSEENSPKWRGLLVPALRKVQEQVHPTLSANEESLYYIEELIFQLLNKLC
MAQPRTIQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
DIGLVSLCEDEPCSSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFLLDRKLFKPSE
IEKIFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQD
ILAPEFNDHFSKLMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLK
ACSEEQDDKECLNQAITALMNLQGSMDRIYKQHSPRRRPGDPVCLFYNRQLRSKHLAIKK
MNEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHGQTRLP
GYSSAEYRLKEKFVMRKIQICDKEDACEYRHAFELVSKDENSVIFAAKSAEEKNNWMAAL
ISLHYRSTLDRMLDSVLLKEENEQPLRLPSPDVYRFVVTDSEENIVFEDNLQSRSGIPII
KGGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADKL
ALEKGEQPISADLKRFRKEYVQPVQLRVLNVFRHWVEHHFYDFERDLELLERLESFISSV
RGKAMKKWVESIAKIIKRKKQAQANGISHNITFESSPPPVEWHISRTGQFETFDLMTLHP
IEIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVE
AENFEERVAVLSRIVEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRRIL
DDAVELSQDHFKKYLVKLKSINPPCVPFFGIYLTNILKTEEGNSDFLKRKGKDLINFSKR
RKVAEITGEIQQYQNQPYCLRTEPEMRRFFENLNPMGILSEKEFTDYLFNKSLEIEPRNC
KQPPRFPRKSTFSLKSPGIRPNAGRHGSTSGTLRGHPTPLEREPYKISFSRIAETELEST
VSAPTSPNTPSTPPVSASSDHSVFLDVDLSSSCGSNTIFAPVLLPHSKTFFSSCGSLHKL
SEEPLIPPPLPPRKKFDHDAPNSKGAMRSDDDPPAIPPRQPPPPKVKPRVPVLMGTFDGP
VLSPPPPPPRDPLPDTPPPVPLRPPEHFINCPFTLQPPPLGHPHRDPDWLRDVSTCPNSP
STPPTTPSPRIPRSCHLLSSSHSSLAHPSAPPVPPRQNSSPHLPKLPPKTYKRELSHPPL
YRLPLLENAETPQ
NT seq 4002 nt   +upstreamnt  +downstreamnt
atgcagcaggcgccgcagccctacgagttcttcagcgaagaaaacagcccgaaatggcgg
ggactgttggtcccggccttgcggaaggttcaggagcaagtacatcccaccctgtcagct
aatgaagagtctctctattatattgaagaactgatttttcagctgcttaataaactatgc
atggctcaaccaaggactattcaagatgttgaggaacgagttcaaaagacctttcctcat
cctattgataaatgggcaattgctgatgcacagtctgccatagagaaacgaaaacgaaga
aatcctcttttactacctgtggacaaaatccacccttccttgaaggaagttttggggtat
aaagtggactaccatgtatccctctatattgtggctgtattggagtatatctcagcagat
attttgaaattggctggtaattacgtctttaatattcgacattatgaaatatctcagcaa
gatattaaagtgtccatgtgtgcagataaggttttgatggacatgtttgatcaggatgat
gatataggcttggtttctctctgtgaagatgaaccttgttcttctggtgagctaaactat
tatgaccttgtcaggactgaaattgcagaagaaagacagtatctacgggagctgaatatg
atcattaaagtgttccgggaagcctttctcttggacagaaagttgttcaagccttctgaa
attgaaaagattttcagtaacatttcagatatacatgaactgactgtgaaacttttaggt
ttaattgaagacacagtagagatgacagatgagagcagtcctcacccattagctggcagc
tgttttgaagacttagcagaggagcaagcgtttgatccctatgaaacattatcacaggac
attcttgcaccagagtttaatgaccacttcagcaagttgatggccagacctgcagttgct
ctacattttcagtccattgctgacggctttaaggaggctgttcgttatgtccttccacgc
ctcatgctggtgccggtgtatcactgttggcattactttgaattattaaagcagttgaag
gcatgcagtgaagagcaggacgacaaagagtgcttgaatcaggctatcactgccctcatg
aacctccaaggcagcatggaccgcatttacaagcagcactcccccagacgccggcctggg
gatcccgtttgccttttttacaatcgtcaattaagaagcaagcacctggctatcaaaaaa
atgaatgaaattcagaaaaacatagatgggtgggaaggcaaagatattggacagtgttgt
aatgagttcataatggagggaccattgaccagaattggtgctaaacatgaaaggcatatt
tttctctttgatggcttaatgatcagctgtaaacccaatcatggccagacccggcttcca
ggttatagcagtgcagaatacagattaaaggagaagtttgtcatgaggaaaattcaaatc
tgtgataaagaagacgcctgtgagtacagacatgcttttgaattagtgtccaaagatgaa
aacagtgtaatatttgctgccaagtcagctgaagagaaaaacaactggatggcagccctc
atttccctgcactatcgcagcactctagacagaatgctggactctgtgctgctgaaagaa
gagaatgagcagcccctgaggctacccagtccagatgtgtatcgctttgtggtaacagac
tctgaggaaaacattgtgtttgaagacaacttgcaaagcagaagtgggatccccataatt
aaaggaggcactgtggtgaaactgattgaaaggctaacataccacatgtatgcagatccc
aattttgttcgtacttttcttactacatatcgttcattttgtaaaccacaggaattgcta
agcttgctgatagaacggtttgaaattccagaaccagaacctactgaggcagacaagctg
gcgttagagaaaggcgagcagccaatcagcgcagatctgaaaagattccgaaaggaatac
gtccaacctgtgcaacttagggtcttgaatgtctttcgccactgggtcgagcatcatttt
tatgactttgaaagagacttggaattgcttgaaagactagaatccttcatttcaagtgta
agagggaaagccatgaagaaatgggtagaatccattgctaaaattatcaaaaggaagaag
caagctcaggcaaatggaataagccataatatcacctttgaaagttcacctccaccagtg
gaatggcacataagtagaacaggacagtttgaaacatttgaccttatgacacttcatcca
atagagattgcacggcagctaacgcttttggaatctgacctctacaggaaagtccagccc
tctgaacttgtagggagtgtctggaccaaagaagataaagaaataaattctccaaattta
ttaaaaatgattcgtcatacaacaaacctcactctgtggtttgagaaatgcattgtggaa
gcagaaaactttgaagaacgggtggcagtgctcagcagaatagtagaaattctgcaagtg
tttcaagacttgaataatttcaatggtgtgttggagatagtgagtgctgtcaattccgtg
tcagtgtacaggctagaccacacgtttgaggcattgcaggaaaggaagcggagaattttg
gatgacgccgtggaactaagtcaggatcactttaaaaaatacctagtaaaacttaaatca
atcaatccgccttgtgtgcctttttttggaatatatttaacaaatattctgaagactgaa
gaagggaatagtgactttctaaagaggaaagggaaagatttgatcaatttcagtaagagg
aggaaagtggctgaaataactggagagattcagcagtatcagaaccaaccgtactgctta
cggacagaaccagaaatgaggagattctttgaaaacctcaaccccatgggaattttatct
gaaaaagagtttacagattatttgttcaacaaatcactagaaatcgaaccccgaaactgc
aaacaaccacctcgatttcctaggaagtccaccttttccttaaaatctcctggaataagg
cccaatgctggccgccatggctctacctcaggcacgttacgaggtcacccaacccctctg
gaaagagagccttataagataagctttagccggatcgctgagacagagctagaatcgaca
gtgtcggcaccaacctctcccaacactccatccaccccaccagtgtccgcttcttctgac
cacagcgtattcctagatgtggacctcagtagctcctgcggcagcaataccatctttgct
ccagtcctcttgccacactcaaagactttcttcagctcatgtggaagtttacacaaactg
agtgaagagccactaattcctcctccgctgccccctcggaaaaagtttgatcatgatgct
cccaattctaagggagctatgagatctgatgatgaccctcctgctattccaccaagacag
cccccgcctccaaaggtaaagccaagagttcctgtcctcatgggtacatttgatgggcct
gtgctcagtccacctccacctcctccaagagaccctcttcctgatacccctccaccagtt
cctcttcggcctccggaacactttataaactgtccatttactcttcagccacctccactg
ggccatcctcacagagacccagactggctcagagacgttagcacgtgtcctaactcacca
agcactcctcccaccacgccctctccacggattccacgcagctgtcacttgctcagctcc
agtcacagcagccttgctcatccttcagctcctcctgttccaccaaggcagaattcaagc
cctcacttaccaaagctgccaccaaagacttacaaacgggagctttcccacccgccactg
tacagactgcctctgcttgaaaatgcagaaactcctcaatga

KEGG   Mus pahari (shrew mouse): 110335780
Entry
110335780         CDS       T05929                                 

Gene name
Sos1
Definition
(RefSeq) son of sevenless homolog 1
  KO
K03099  son of sevenless
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04062  Chemokine signaling pathway
mpah04068  FoxO signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04510  Focal adhesion
mpah04540  Gap junction
mpah04630  JAK-STAT signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04660  T cell receptor signaling pathway
mpah04662  B cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04714  Thermogenesis
mpah04722  Neurotrophin signaling pathway
mpah04810  Regulation of actin cytoskeleton
mpah04910  Insulin signaling pathway
mpah04912  GnRH signaling pathway
mpah04915  Estrogen signaling pathway
mpah04917  Prolactin signaling pathway
mpah04926  Relaxin signaling pathway
mpah04935  Growth hormone synthesis, secretion and action
mpah05034  Alcoholism
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05210  Colorectal cancer
mpah05211  Renal cell carcinoma
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05220  Chronic myeloid leukemia
mpah05221  Acute myeloid leukemia
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110335780 (Sos1)
   04012 ErbB signaling pathway
    110335780 (Sos1)
   04014 Ras signaling pathway
    110335780 (Sos1)
   04630 JAK-STAT signaling pathway
    110335780 (Sos1)
   04068 FoxO signaling pathway
    110335780 (Sos1)
   04072 Phospholipase D signaling pathway
    110335780 (Sos1)
   04151 PI3K-Akt signaling pathway
    110335780 (Sos1)
   04150 mTOR signaling pathway
    110335780 (Sos1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110335780 (Sos1)
   04540 Gap junction
    110335780 (Sos1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110335780 (Sos1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110335780 (Sos1)
   04660 T cell receptor signaling pathway
    110335780 (Sos1)
   04662 B cell receptor signaling pathway
    110335780 (Sos1)
   04664 Fc epsilon RI signaling pathway
    110335780 (Sos1)
   04062 Chemokine signaling pathway
    110335780 (Sos1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110335780 (Sos1)
   04912 GnRH signaling pathway
    110335780 (Sos1)
   04915 Estrogen signaling pathway
    110335780 (Sos1)
   04917 Prolactin signaling pathway
    110335780 (Sos1)
   04926 Relaxin signaling pathway
    110335780 (Sos1)
   04935 Growth hormone synthesis, secretion and action
    110335780 (Sos1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110335780 (Sos1)
  09159 Environmental adaptation
   04714 Thermogenesis
    110335780 (Sos1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110335780 (Sos1)
   05206 MicroRNAs in cancer
    110335780 (Sos1)
   05205 Proteoglycans in cancer
    110335780 (Sos1)
   05231 Choline metabolism in cancer
    110335780 (Sos1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110335780 (Sos1)
   05225 Hepatocellular carcinoma
    110335780 (Sos1)
   05226 Gastric cancer
    110335780 (Sos1)
   05214 Glioma
    110335780 (Sos1)
   05221 Acute myeloid leukemia
    110335780 (Sos1)
   05220 Chronic myeloid leukemia
    110335780 (Sos1)
   05211 Renal cell carcinoma
    110335780 (Sos1)
   05215 Prostate cancer
    110335780 (Sos1)
   05213 Endometrial cancer
    110335780 (Sos1)
   05224 Breast cancer
    110335780 (Sos1)
   05223 Non-small cell lung cancer
    110335780 (Sos1)
  09165 Substance dependence
   05034 Alcoholism
    110335780 (Sos1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110335780 (Sos1)
   05160 Hepatitis C
    110335780 (Sos1)
   05163 Human cytomegalovirus infection
    110335780 (Sos1)
   05165 Human papillomavirus infection
    110335780 (Sos1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110335780 (Sos1)
   01522 Endocrine resistance
    110335780 (Sos1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mpah04990]
    110335780 (Sos1)
Domain-containing proteins not elsewhere classified [BR:mpah04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   110335780 (Sos1)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_19 IQ_SEC7_PH PH_10 PH_13
Other DBs
NCBI-GeneID: 110335780
NCBI-ProteinID: XP_021073789
Ensembl: MGP_PahariEiJ_G0020898
LinkDB
Position
18
AA seq 1319 aa
MQAQQLPYEFFSEENAPKWRGLLVPALKKVQGQVHPTLESNDDALQYVEELILQLLNMLC
QAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPAERIHHLLREVLGY
KIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDV
EDINILSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLFSSY
DVENIFSRIVDIHELSVKLLGHIEDTVEMTDEGSPHPLVGSCLEDLAEELAFDPYESYAR
DILRPGFHDRFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQL
EEKSEDQEDKECMKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK
KMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRL
PGASSAEYRLKEKFFMRKVQINDKDDTSEYKHAFEIILKDGNSVIFSAKSAEEKNNWMAA
LISLQYRSTLERMLDVTVLQEEKEEQMRLPSADVYRFAEPDSEENILFEENVQPKAGIPI
IKAGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADR
IAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDADLLQRMEEFIGT
VRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTVEWHISRPGHIETFDLLTLH
PIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIV
ETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQVPSRQRKI
LEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLRRHGKELINFSK
RRRVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIEPRN
PKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETESPASAP
NSPRTPLTPPPASGTSSNTDVCSVFDSDHSASPFHSRSASVSSISLSKGTDEVPVPPPVP
PRRRPESAPAESSPSKIMSKHLDSPPAIPPRQPTSKAYSPRYSISDRTSISDPPESPPLL
PPREPVRTPDVFSSSPLHLQPPPLGKKSDHGNAFFPNSPSPFTPPPPQTPSPHGTRRHLP
SPPLTQEMDLHSIAGPPVPPRQSTSQLIPKLPPKTYKREHTHPSMHRDGPPLLENAHSS
NT seq 3960 nt   +upstreamnt  +downstreamnt
atgcaggcgcagcagctgccctacgagtttttcagcgaggagaacgcgcccaagtggcgg
gggctgctggtgcctgcgctgaaaaaggttcaggggcaagttcaccctactcttgagtct
aatgatgatgctcttcagtatgttgaagaattaattttgcaattactaaatatgctgtgc
caagctcagccccggagtgcttcagatgtggaggaacgtgttcaaaaaagttttcctcat
ccaattgataagtgggcaatagctgatgcccaatcagctattgaaaagaggaagagaagg
aatcctttatccctgccagcagaaagaattcatcatttgttaagggaggtcctcggttat
aaaattgaccaccaggtttctgtttacatagtagcagtattagaatacatttctgcagat
attttaaagttggtggggaattatgtaagaaatatacggcattatgaaattacaaaacaa
gacattaaagtggcaatgtgtgctgataaggtattgatggatatgtttcatcaagatgta
gaggatataaatatcttatctttaactgatgaagaaccttccacctcaggagaacaaact
tactatgatttggtaaaagcattcatggcagaaattcgacagtatataagagaattaaat
ctaattataaaagtttttcgagaaccctttgtctctaattccaaattgttctcatcttat
gatgtagaaaacatatttagtcgtatagtagatatacatgaacttagtgtaaagttactg
ggccatatagaagacactgtagagatgacagacgaaggcagcccccacccattagtagga
agctgtttggaagacttagcagaagaactggcatttgatccatatgaatcatatgctcgg
gatattttacgacctggattccatgaccgttttcttagtcagttatcaaagcctggggca
gcactttatttgcagtcaataggcgaaggcttcaaagaagctgttcagtatgttttgccc
cggctgctgcttgcccctgtgtaccactgtctgcattactttgaacttctgaagcagtta
gaagaaaagagtgaagatcaagaagacaaggagtgtatgaagcaagcaataacagccctg
cttaacgtccaaagtggcatggaaaaaatttgctccaaaagtcttgcaaaacgaagacta
agtgagtctgcatgtcggttttacagccagcagatgaaggggaaacaactagccatcaag
aaaatgaacgagatccagaagaatattgatggttgggaggggaaagacattggacagtgc
tgcaatgagttcataatggaaggaactcttacacgtgtaggagccaaacacgagagacac
atatttctcttcgatggcttaatgatttgctgtaaatcaaatcatgggcagccaagactc
cctggtgctagcagtgcagaatatcggcttaaagaaaaattttttatgcgaaaggtacaa
attaatgataaagatgataccagtgaatacaagcatgcttttgaaatcattctgaaagat
ggaaatagtgttatattttctgccaagtcagctgaagagaaaaacaactggatggcagca
ctgatatctttgcagtaccgcagcaccctggagaggatgctggacgtaacagtgctgcag
gaagagaaggaggagcagatgaggctgcctagtgctgatgtgtacaggtttgcagaacct
gactccgaggagaatattctattcgaagagaatgtgcagcccaaagctgggatccccatt
atcaaagcagggactgtggttaaactcattgagaggcttacataccatatgtacgcagat
ccaaattttgttcggacgtttcttacaacatacagatccttttgcaaacctcaagaacta
ctgagtcttctaatagaaagatttgaaattccagagcctgagccaacagaagctgatcgc
atagctatagagaacggagaccagcccctgagtgcagagctgaagaggtttaggaaggaa
tatatccagcctgtgcagctgagggtgttgaatgtgtgtcggcactgggtggagcaccat
ttctatgactttgaaagagatgcagaccttttacagagaatggaggaatttattggaaca
gtaagaggtaaagcaatgaaaaaatgggtcgaatccatcactaagataatccaaaggaaa
aaaattgcaagagacaatggcccaggtcataatattacatttcagagttcacctcccaca
gttgagtggcacataagcagacccgggcacatagagacttttgacttgctcaccttacac
ccaatagaaattgctcgacaactcactttacttgaatcagatctataccgagctgtgcag
ccatcagaattagttggaagtgtgtggacaaaagaagataaagaaattaattctcccaac
cttctgaagatgattcggcacaccactaacctcactttgtggtttgagaaatgtattgta
gaaacagaaaacttagaagaaagagtagctgtagtgagtcggataattgagattctacaa
gtctttcaagagctgaacaacttcaatggtgtcctggaagttgtcagtgctatgaactca
tcgcctgtttacagactagaccacacatttgagcaagtaccaagtagacaaaggaaaatt
ttagaagaagctcatgaattgagtgaagatcactataagaaatatttggcaaaactcagg
tctattaatccaccatgtgtgcctttctttggaatttatctcacaaatatcttgaagaca
gaagaaggcaaccctgaggtcctaagaagacatggaaaagagctcatcaacttcagcaag
aggaggagagtggctgagataacaggggagatccagcagtaccaaaaccagccttactgc
ttacgggtggagtcagacatcaagaggttctttgaaaacttgaatccaatgggaaatagc
atggagaaagaatttacagactatctattcaacaaatccctagaaatagagccgcggaac
cctaagcctctcccgagattcccaaaaaaatacagctatcccctaaaatctcctggtgtt
cgtccatcaaatccaagaccaggaaccatgagacatcccacgcctctgcagcaggagcca
agaaaaattagctacagtaggatccctgagagtgagacagaaagtccagcgtctgcacca
aattccccgagaacaccactgacacctcctcctgcatctggcacttccagtaacacagat
gtttgcagcgtgttcgattctgaccattcagcaagcccttttcattcaagatctgcttca
gtctcatctataagtttatccaagggcactgacgaagtgcctgttccccctcctgtaccc
ccacgaaggcgtccagagtctgccccagctgaatcctccccatccaagattatgtctaag
cacttggacagccccccagctattcctcctaggcaacccacatcaaaagcctattcccca
cgatattcaatatcagatcggacctctatatcagatcctcctgagagccctcccttgtta
ccaccacgggaacctgtgaggacacctgatgttttctcaagctcgccattacatctccaa
cctcctcctttgggcaaaaagagtgatcatggcaatgccttcttcccaaacagcccatcc
ccttttacaccgccaccccctcaaaccccttctcctcatggcacgagaaggcatctgcca
tcaccaccactgacacaggaaatggacctccactccattgctgggcctcctgttcctcca
cgacaaagcacttctcaacttatccccaaactccctccaaaaacttacaaaagggagcat
acacacccatccatgcatagagacggaccacctctgctggagaatgcccattcttcctga

DBGET integrated database retrieval system