KEGG   Mus pahari (shrew mouse): 110324431
Entry
110324431         CDS       T05929                                 

Gene name
Frmd6
Definition
(RefSeq) FERM domain-containing protein 6 isoform X1
  KO
K16822  FERM domain-containing protein 6
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
mpah04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110324431 (Frmd6)
   04392 Hippo signaling pathway - multiple species
    110324431 (Frmd6)
SSDB
Motif
Pfam: FERM_M FERM_C FERM_N
Other DBs
NCBI-GeneID: 110324431
NCBI-ProteinID: XP_021057658
Ensembl: MGP_PahariEiJ_G0029577
LinkDB
Position
7
AA seq 622 aa
MNKLTFHNNKVMQDRRRVCIFLPNDKSVSIIINVKILCHQLLVQVCDLLRLKDSHLFGLS
VIQNNEHVYMELSQKLYKYCPKEWKKEASKVRQYEVTWGIDQFGPPMIIHFRVQYYVENG
KLISDRIARYYYYWHLRKQVLHSQCVLREEAYFLLAAFALQADLGNFKRKVHHGDYFEPE
AYFPAWVVSKRGKDYILKHIPNMHKDQFALTASEAYLKYIKEAVRLDDVAIHYYRLYKDK
REVEGSLTLGLTMRGIQIFQNLEEEKQLLYDFPWTNVGKLVFVGKKFEILPDGLPSARKL
VYYTGCPTRSRHLLQLLSNSHRLYMNLQPVLRHLRKQEENEEKKQYRESYISDNLDLDMD
PLEKRSRASGSSAGSVKHKRLSRHSTASHSSSHTSGIEADTKPRDPGPEDSCSGSAMHRK
LKTCSSMTSHGSSHTSGVESGGKDRLEEDSQDDEIEMLVDDPRDLERMTEESLEVSPEMC
IYITEDMLLSRKLNGHSGLIVKEISSSTSSSSETVVKLRGQSTDSLPQTICRKPKTSTDR
HSLSLDDIRLYQKDFLRIAGLCQDTAQSYTFGCGHELDESGLYCKGCLAQQCVNIEDAFP
VKRASKYFSLDLTHDEVPEFVV
NT seq 1869 nt   +upstreamnt  +downstreamnt
atgaacaaactgaccttccataacaacaaagtcatgcaggaccgccgcagagtgtgtatt
ttcctccccaatgacaagtccgtgagcatcatcataaatgttaaaattctgtgtcaccag
ttgctggtccaggtgtgtgacctgctcaggttaaaggacagtcacctctttggtctcagt
gttatacaaaataatgaacatgtatatatggagttgtcacaaaagctttataagtattgt
ccgaaagaatggaaaaaggaggccagcaaggtacggcaatacgaagtcacttggggcatc
gaccagtttgggccccccatgatcatccacttccgggtgcagtactacgtggagaatggg
aagctgatcagtgaccgaattgcaagatactattattactggcacctaaggaaacaggtg
ctgcactcgcagtgtgtgctcagagaggaggcctacttcctgctggcagcctttgccctg
caagctgacctcggcaacttcaaaaggaaagtgcatcacggagactactttgagccggag
gcttacttcccggcatgggttgtttccaagagggggaaggactacatcctgaagcacatt
ccaaacatgcacaaggaccagtttgccttgacggcctccgaggcctacctgaagtacatc
aaagaggccgtccgactggacgacgtcgccatccattactacagactgtacaaggataag
agggaggttgaaggctcactgaccctgggactgactatgcgaggaatacagattttccag
aatctagaagaagagaaacaattgctctatgatttcccctggacaaatgttgggaagttg
gtgtttgtgggcaagaagtttgagattttgccagatggccttccctccgccaggaagctg
gtctactacacagggtgtcccacgcgctctcggcatcttctacagctcctgagcaacagc
caccgcctctacatgaacctgcagcccgtccttcgccacctccgcaagcaggaggagaat
gaagagaaaaagcagtaccgggaatcctacatcagcgacaacctggaccttgacatggac
ccgctggaaaagcggtcccgagccagtgggagcagcgctggcagcgtgaagcacaagcgc
ctgtcccgccactccacagccagccacagcagctcccacacctcgggcatcgaggcagac
accaagccccgggacccagggccagaagacagctgttcaggcagtgccatgcaccggaag
ctgaagacctgcagctccatgaccagccacggcagctcccacacctcaggggttgagagt
ggaggcaaagaccgcctggaagaggactcgcaagatgatgaaatagagatgctggtcgat
gaccccagggacctggagcggatgactgaagagtcactggaagtcagtccagagatgtgt
atctacatcacagaagatatgctcctgtcaaggaagctgaacggacactcagggttaatt
gtgaaagaaatcagttcctccacctccagctcttcagaaacggttgtcaagctgcgtggt
caaagcaccgactctcttccacagacgatatgtcgaaaaccaaagacttccacggatcgc
catagcctgagccttgacgacatcagactgtaccagaaagacttcctgcgcattgctggc
ctgtgtcaggacactgctcagagctacacattcgggtgtggccatgaactggatgagagc
ggtctctactgcaagggctgcctggctcagcagtgcgtcaacatagaggacgcgtttcca
gtgaaaagagccagcaagtacttctctctggacctcactcacgacgaagtcccagagttt
gtcgtctaa

DBGET integrated database retrieval system