KEGG   Mus pahari (shrew mouse): 110324496
Entry
110324496         CDS       T05929                                 

Gene name
Id2
Definition
(RefSeq) DNA-binding protein inhibitor ID-2
  KO
K17693  DNA-binding protein inhibitor ID2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04350  TGF-beta signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110324496 (Id2)
   04390 Hippo signaling pathway
    110324496 (Id2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110324496 (Id2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110324496 (Id2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110324496 (Id2)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    110324496 (Id2)
SSDB
Motif
Pfam: HLH
Other DBs
NCBI-GeneID: 110324496
NCBI-ProteinID: XP_021057783
Ensembl: MGP_PahariEiJ_G0029409
LinkDB
Position
7
AA seq 134 aa
MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVT
KMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEF
PSELMSNDSKVLCG
NT seq 405 nt   +upstreamnt  +downstreamnt
atgaaagccttcagtccggtgaggtccgttaggaaaaacagcctgtctgaccacagcttg
ggcatctcccggagcaaaaccccggtggacgacccgatgagtctgctctacaacatgaac
gactgctactccaagctcaaggaactggtgcccagcatcccccagaacaagaaggtgacc
aagatggaaatcctgcagcacgtcatcgattacatcttggacctgcagatcgccctggac
tcgcatcccactatcgtcagcctgcaccaccagagacctggacagaaccaggcgtccagg
acgccgctgaccaccctgaacacggacatcagcatcctgtccttgcaggcatctgaattc
ccttctgagcttatgtcgaatgatagcaaagtactctgtggctaa

DBGET integrated database retrieval system