KEGG   Mus pahari (shrew mouse): 110324646
Entry
110324646         CDS       T05929                                 

Gene name
Adcy3
Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00230  Purine metabolism
mpah01100  Metabolic pathways
mpah01522  Endocrine resistance
mpah04015  Rap1 signaling pathway
mpah04020  Calcium signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04114  Oocyte meiosis
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04270  Vascular smooth muscle contraction
mpah04371  Apelin signaling pathway
mpah04540  Gap junction
mpah04611  Platelet activation
mpah04713  Circadian entrainment
mpah04714  Thermogenesis
mpah04723  Retrograde endocannabinoid signaling
mpah04724  Glutamatergic synapse
mpah04725  Cholinergic synapse
mpah04727  GABAergic synapse
mpah04740  Olfactory transduction
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04911  Insulin secretion
mpah04912  GnRH signaling pathway
mpah04913  Ovarian steroidogenesis
mpah04914  Progesterone-mediated oocyte maturation
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04918  Thyroid hormone synthesis
mpah04921  Oxytocin signaling pathway
mpah04923  Regulation of lipolysis in adipocytes
mpah04925  Aldosterone synthesis and secretion
mpah04926  Relaxin signaling pathway
mpah04927  Cortisol synthesis and secretion
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04934  Cushing syndrome
mpah04935  Growth hormone synthesis, secretion and action
mpah04962  Vasopressin-regulated water reabsorption
mpah04970  Salivary secretion
mpah04971  Gastric acid secretion
mpah04972  Pancreatic secretion
mpah04976  Bile secretion
mpah05032  Morphine addiction
mpah05163  Human cytomegalovirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05200  Pathways in cancer
mpah05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110324646 (Adcy3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110324646 (Adcy3)
   04371 Apelin signaling pathway
    110324646 (Adcy3)
   04020 Calcium signaling pathway
    110324646 (Adcy3)
   04072 Phospholipase D signaling pathway
    110324646 (Adcy3)
   04024 cAMP signaling pathway
    110324646 (Adcy3)
   04022 cGMP-PKG signaling pathway
    110324646 (Adcy3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110324646 (Adcy3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110324646 (Adcy3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110324646 (Adcy3)
   04062 Chemokine signaling pathway
    110324646 (Adcy3)
  09152 Endocrine system
   04911 Insulin secretion
    110324646 (Adcy3)
   04923 Regulation of lipolysis in adipocytes
    110324646 (Adcy3)
   04912 GnRH signaling pathway
    110324646 (Adcy3)
   04913 Ovarian steroidogenesis
    110324646 (Adcy3)
   04915 Estrogen signaling pathway
    110324646 (Adcy3)
   04914 Progesterone-mediated oocyte maturation
    110324646 (Adcy3)
   04921 Oxytocin signaling pathway
    110324646 (Adcy3)
   04926 Relaxin signaling pathway
    110324646 (Adcy3)
   04935 Growth hormone synthesis, secretion and action
    110324646 (Adcy3)
   04918 Thyroid hormone synthesis
    110324646 (Adcy3)
   04928 Parathyroid hormone synthesis, secretion and action
    110324646 (Adcy3)
   04916 Melanogenesis
    110324646 (Adcy3)
   04925 Aldosterone synthesis and secretion
    110324646 (Adcy3)
   04927 Cortisol synthesis and secretion
    110324646 (Adcy3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110324646 (Adcy3)
   04270 Vascular smooth muscle contraction
    110324646 (Adcy3)
  09154 Digestive system
   04970 Salivary secretion
    110324646 (Adcy3)
   04971 Gastric acid secretion
    110324646 (Adcy3)
   04972 Pancreatic secretion
    110324646 (Adcy3)
   04976 Bile secretion
    110324646 (Adcy3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    110324646 (Adcy3)
  09156 Nervous system
   04724 Glutamatergic synapse
    110324646 (Adcy3)
   04727 GABAergic synapse
    110324646 (Adcy3)
   04725 Cholinergic synapse
    110324646 (Adcy3)
   04723 Retrograde endocannabinoid signaling
    110324646 (Adcy3)
  09157 Sensory system
   04740 Olfactory transduction
    110324646 (Adcy3)
   04750 Inflammatory mediator regulation of TRP channels
    110324646 (Adcy3)
  09149 Aging
   04211 Longevity regulating pathway
    110324646 (Adcy3)
   04213 Longevity regulating pathway - multiple species
    110324646 (Adcy3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110324646 (Adcy3)
   04714 Thermogenesis
    110324646 (Adcy3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110324646 (Adcy3)
  09165 Substance dependence
   05032 Morphine addiction
    110324646 (Adcy3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    110324646 (Adcy3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110324646 (Adcy3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110324646 (Adcy3)
   05163 Human cytomegalovirus infection
    110324646 (Adcy3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110324646 (Adcy3)
Enzymes [BR:mpah01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     110324646 (Adcy3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Peptidase_S49_N NCE101
Other DBs
NCBI-GeneID: 110324646
NCBI-ProteinID: XP_021057978
Ensembl: MGP_PahariEiJ_G0029340
LinkDB
Position
7
AA seq 967 aa
MAGGGTLRLRAHGFGPQLDSEVRKPRAQITFCVAYSFAFLSFVLGNQILANVFLYLCAII
VGIMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKD
ESQKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKY
HQLRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTG
TVLGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSR
CDYLDEKGIETYLIIASKPEVKKTAQNGLNGSALPNGAPASSKPSSPALIETKEPNGSAP
ASGSTSEEAEEQEVGADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERES
AQVVKKRNTFLLTMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLFCTAMVEILMDPWLVT
NYVTFVVGEALLLILTICSMAAIFPRSFPKKLVAFSSWIDRTRWARNTWAMLAIFILVMA
NVVDMLSCLQYYMGPYNVTAGMELDGGCMGNPKYYNYVAVLSLIATIMLVQVSHMVKLTL
MLLVTGAVTAINLYAWCPVFDEYDHKRFQEKDFPMVALEKMQVLATPGLNGTDSRLPLVP
SKYSMTVMMFIMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLP
EHVARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIIS
DFDSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSSKEEKSDKERWQHLADLA
DFALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMEST
GVMGNIQVVEDTQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDRPAAFPNGSSVTLP
HQVVDNP
NT seq 2904 nt   +upstreamnt  +downstreamnt
atggcgggaggaggaaccttaaggttgagagcccatggcttcggaccacagctagacagt
gaggtgaggaagcctcgcgctcagatcactttctgtgtggcttactcttttgcctttctt
tcatttgttcttggcaatcagatcctggccaacgtcttcctctacctatgtgctatcatt
gtgggcatcatgtcctactacatggcagaccgcaagcaccgcaaggccttcctggaggcc
cgccagtcactggaggtgaagatgaatctggaggagcagagccagcagcaggaaaacctt
atgctttccatcctgcccaagcacgtggctgacgagatgctgaaggacatgaagaaggat
gagagccagaaggaccagcagcagttcaacaccatgtacatgtaccggcacgagaatgtc
agcatcctgtttgcagatattgtgggctttacccagctgtcctccgcttgtagcgcccag
gagctagtgaagctactcaacgagctctttgcccgctttgacaagctggcagccaaatac
caccagctgaggatcaagatcctaggcgactgttactattgcatctgcggcctgcctgac
taccgggaggaccacgccgtgtgctccatccttatggggcttgccatggttgaggccatc
tcgtacgtgcgagaaaagaccaagactggagtggacatgcgtgtgggagtgcacacgggc
actgtcctaggtggtgtcctgggccagaagcgctggcagtatgatgtatggtctactgat
gtcaccgtggcaaacaagatggaggctggtggcatcccagggcgcgtgcacatttcccag
agcaccatggactgcctgaagggggagtttgatgtggagcctggtgatgggggcagtcgc
tgtgactacctagatgagaagggcatcgaaacctacctcatcattgcctccaagccagag
gtgaagaaaacagcccaaaatggcctcaacggctcggccctgccaaatggagcgccggca
tcctccaaacccagctcccctgccctcattgagaccaaggagcccaatgggagtgcccct
gccagcggctccacatcagaggaggctgaagaacaggaggtgggtgctgacaacccctcg
ttccccaacccccgccgcaggctgcgcctccaggacctggcagaccgcgtggtggacgcc
tctgaggatgagcacgaactgaaccagctgcttaacgaggccctgctggagcgggagtcc
gcccaggtggtaaagaagagaaacacattcctcctaaccatgaggttcatggacccagag
atggaaacacgctactcggtggagaaggagaagcagagtggggccgccttcagctgctcc
tgtgtggtcctcttctgcacggccatggtggagatactcatggacccctggctggtgaca
aactacgtgacctttgtggttggggaggctttgctcctgatcctgactatctgctcgatg
gctgccatctttcccaggtcatttcccaagaagctcgtggccttctcatcttggattgac
cggacccgctgggcaaggaacacctgggccatgttagccatcttcattctggttatggcc
aatgttgtggatatgcttagctgtctccaatactacatgggaccttacaacgtgacagcc
gggatggagctggacggcggctgtatggggaaccccaagtactacaactacgttgctgtg
ctgtcgcttatcgccaccatcatgctggtgcaggtcagccacatggtaaagctgacactc
atgctgctcgtcacaggcgccgtgactgccatcaacctgtatgcctggtgtcctgtcttt
gatgaatacgaccacaagcgctttcaggaaaaggactttcctatggtggccttagagaag
atgcaggtacttgccacccctgggctcaatggcactgacagcaggctgcccctggtgcct
tccaagtactcaatgactgtgatgatgttcatcatgatgctgagcttttactacttctca
cgtcacgtggaaaaactggcccgaacactgttcttgtggaagattgaggtccatgaccag
aaagaacgtgtctacgagatgcgccgatggaatgaggccttggtcaccaacatgttgcct
gagcatgttgcacgccatttcctggggtccaagaagagagatgaggagctgtacagccag
tcttatgacgagattggagtcatgtttgcctccttgcccaactttgccgacttctacact
gaggagagcatcaacaatggtggcatcgagtgtcttcgcttcctcaatgagatcatctct
gattttgactctctcctggacaatcccaaattccgggtcatcaccaagatcaaaactatt
ggcagtacctatatggcagcttcaggagtcacaccagatgtcaacaccaatggcttcacg
agctccagcaaggaggagaagtcagacaaggagcgctggcagcacctggctgacctggcc
gactttgcattagccatgaaagacacgctcacaaacatcaacaaccagtcattcaacaac
ttcatgctgcgcataggcatgaacaaaggaggggttctggctggtgtcattggagcccgg
aaaccacactatgacatctggggcaatacggtcaatgtggccagcaggatggaatccaca
ggagtcatgggcaacatccaggtggtagaagacacacaggtcatccttcgagagtatggc
ttccgctttgtgaggcgaggtcccatctttgtgaaaggcaaaggggaacttctgaccttt
ttcttgaagggacgggacaggccagctgccttccccaatggctcctctgttacactgccc
caccaagtggtggacaacccctga

DBGET integrated database retrieval system