KEGG   Mus pahari (shrew mouse): 110325021
Entry
110325021         CDS       T05929                                 

Definition
(RefSeq) interleukin-3 receptor subunit alpha-like
  KO
K04737  interleukin 3 receptor alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04210  Apoptosis
mpah04630  JAK-STAT signaling pathway
mpah04640  Hematopoietic cell lineage
mpah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110325021
   04151 PI3K-Akt signaling pathway
    110325021
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110325021
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110325021
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110325021
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110325021
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110325021
   04090 CD molecules [BR:mpah04090]
    110325021
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IL3 receptor family
   110325021
CD molecules [BR:mpah04090]
 Proteins
  110325021
SSDB
Motif
Pfam: IL6Ra-bind IL3Ra_N
Other DBs
NCBI-GeneID: 110325021
NCBI-ProteinID: XP_021058482
Ensembl: MGP_PahariEiJ_G0029976
LinkDB
Position
8
AA seq 395 aa
MATNLWLLLGLLTSQSSELAATREAPPTVVTTLIRNLRIDPAHRTLSWDPAPSTDITTEF
ACRKDGDLFSVRGGAWADPGLTRCSFPSLSLCRSTDFAVLLGEDRVEVGSIRFPPDDGGD
REAAAKDLRCWVHDVGRLSCRWERGPRAAGDVRYRMFWRDTQLDPTHDRECPHYHSDDVT
ATGPAPHGGHEGCTLDLDPDLGSDTQVDVTVNGSGHAGPVPCMDDTMDLQHVEVLVPPTL
KVECSGSDAHVQWFPQTRFHHNLLGFTLQVNQSSRPVLQEFNFSTTHFRVPNAGAITFRV
RARSEVDPGKLSGWSNTWGLVCPLEVKSMTTVLVTSAAVVLGTGLIAAGFLLCWRKSLLS
RLCPPIPHLRLPLAGETVAWAPAPEDCEVTPVTDA
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggccaccaacctgtggctcctcctggggctgctgacatcacagtcttcagagctggct
gccacccgcgaggccccgcccactgttgtgaccacgctcatccggaacctgcgcatcgac
cccgcccatcgcacactgagctgggaccccgcccccagcactgacatcacaacagagttt
gcctgcaggaaggacggggacctattttcggtgaggggcggggcctgggccgacccgggg
cttacccgctgctcgttcccgtcgctctccctctgccgctcgaccgactttgccgtcctc
ctgggggaggacagggtggaggtcggatccatccggttccccccagatgacggtggcgac
cgcgaggctgcggccaaggacctgcgctgctgggtgcatgacgtggggcggctgagctgc
cgctgggaacggggccccagggctgcgggcgatgtgcgctaccggatgttctggcgtgac
acgcagctcgatcccacccatgaccgcgagtgtccacactaccacagcgatgatgtcact
gccactggccccgcccctcatggtggccatgaagggtgcaccctcgacctcgaccctgac
cttggctctgacacccaggtcgatgtcactgtcaacggcagcggccatgcgggccccgtg
ccctgcatggatgacaccatggacctgcagcatgtggaggtcctggtcccgcccacgctg
aaggtcgagtgcagcggctctgatgcccatgtgcaatggttcccgcagacccggttccac
cacaacctcctcgggttcaccctgcaggtcaaccagagctcacgcccagtgctgcaggaa
ttcaatttctccaccacccacttccgggtccccaacgctggtgccatcaccttccgggta
agggcgaggtcagaagttgacccagggaagctaagcggctggagcaacacctggggccta
gtctgccccctcgaggtgaagtctatgacgacggtactggtgacatcggcagctgtggtt
ctggggacagggctcatagcagctgggttcctgctgtgctggaggaagtcgctgctgtcc
cgcctgtgtccacccatcccgcatctgcgcctgcccttggcaggggagacagttgcatgg
gccccggcgcccgaggactgtgaggtgacgcctgtgacggacgcctga

DBGET integrated database retrieval system