KEGG   Mus pahari (shrew mouse): 110325431
Entry
110325431         CDS       T05929                                 

Gene name
Ajuba
Definition
(RefSeq) LIM domain-containing protein ajuba
  KO
K16682  LIM domain-containing protein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
mpah04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110325431 (Ajuba)
   04392 Hippo signaling pathway - multiple species
    110325431 (Ajuba)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mpah03019]
    110325431 (Ajuba)
   03036 Chromosome and associated proteins [BR:mpah03036]
    110325431 (Ajuba)
Messenger RNA biogenesis [BR:mpah03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     110325431 (Ajuba)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     110325431 (Ajuba)
SSDB
Motif
Pfam: LIM
Other DBs
NCBI-GeneID: 110325431
NCBI-ProteinID: XP_021059093
Ensembl: MGP_PahariEiJ_G0030279
LinkDB
Position
8
AA seq 547 aa
MERLGEKASRLLEKLRLSDSGSAKFGRRKGEASRSGSDGTPGAGKGRLSGLGGPRKSGHR
GANGGPGDEPLEPAREQGPLDAERNARGSFEAQRFEGSFPGGPPPTRALPLPLSSPPDFR
LESTAPALSPRSSFASSSASDASKPSSPRGSLLLDGAGASGAGGSRPCSNRTSGISMGYD
QRHGSPLPAGPCLFGLPLTTAPAGYSGGAPSAYPELHAALDRLCAHRPVGFGCQESRHSY
PPALGSPGALTGAVVGTAGPLERRGAQPGRHSVTGYGDCAAGTRYQDELTALLRLTVATG
GREAGARGEPSGIEPSGLEDSPGPFVPEASRSRIREPEAREDYFGTCIKCNKGIYGQSNA
CQALDSLYHTQCFVCCSCGRTLRCKAFYSVNGSVYCEEDYLFSGFQEAAEKCCVCGHLIL
EKILQAMGKSYHPGCFRCIVCNKCLDGVPFTVDFSNQVYCVTDYHKNYAPKCAACGQPIL
PSEGCEDIVRVISMDRDYHFECYHCEDCRMQLSDEEGCCCFPLDGHLLCHGCHMQRLSAR
QPPTNYI
NT seq 1644 nt   +upstreamnt  +downstreamnt
atggaacggttaggggagaaagccagtcgtctgctggaaaagttgagactctcggactcc
ggcagcgccaagttcggccgcagaaagggcgaagcgagccggtctgggtctgatgggacc
cccggagcaggcaagggacgtctgagtgggttggggggacctaggaagtcaggacaccgt
ggagcgaatggggggcctggggatgaacctttggaaccggccagggagcaagggcccctg
gacgccgagcggaacgcacgcggctcctttgaagcgcagcgcttcgaagggtcctttccc
ggggggccgccgcccactcgagccttgcctctgcctctgtcgtcgcctcctgattttcgg
ctggagagcacggctccagcccttagccctcgctccagcttcgccagtagctcggccagc
gatgcgagcaagccatccagcccccggggcagcctgctgctggacggagcgggggccagc
ggagccggaggtagccggccgtgcagcaatcggaccagcggcatcagcatgggctacgac
cagcgccacgggagcccgctgcccgcggggccgtgcctattcggcctcccgctgaccact
gctcctgcgggctactccggaggggctccgtccgcctacccggagctccacgctgccctg
gaccgactatgtgctcatcggcccgtgggattcggctgccaggagagccgtcactcgtac
cccccggccctaggcagccccggagctctaaccggagccgtggtgggaacagcgggtcct
ttggagagacgtggggcgcaacccggacgacactcggttacaggctatggggactgcgcc
gcggggacccgttaccaggacgagctaacagcattgctgcgtttgacggtggctactggt
gggcgagaagccggtgcccgcggggaaccctcggggattgagccgtcgggtctggaggat
tctcctggtcccttcgttccagaggcctcccgatcacggatacgggagccagaggccaga
gaagactactttggcacctgtatcaagtgcaacaaaggtatctatgggcagagcaatgcc
tgccaggccctggacagcctctaccacacccagtgctttgtctgctgctcctgtggacga
actttgcggtgcaaggctttctacagcgtcaatggctctgtctactgtgaggaagattat
ctgttttcagggtttcaggaggcagctgagaagtgctgtgtctgtggccacttgattcta
gagaagatcctccaggccatggggaagtcctatcacccgggctgcttccgatgcatcgtt
tgtaacaagtgcctggatggtgtccccttcactgtggacttctccaaccaggtgtactgt
gtcaccgactaccacaagaattacgccccgaaatgtgcagcctgcggacaacccatcctc
ccttcagagggctgtgaggacattgtgagagtgatatccatggaccgtgattatcacttt
gagtgctaccactgtgaggactgccgcatgcagctgagcgacgaggaaggttgctgctgt
ttccctcttgacggacatttgctctgccacggctgtcacatgcagcgcctcagtgcccga
cagccccctaccaactatatctga

KEGG   Mus pahari (shrew mouse): 110327504
Entry
110327504         CDS       T05929                                 

Gene name
Limd1
Definition
(RefSeq) LIM domain-containing protein 1
  KO
K16682  LIM domain-containing protein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
mpah04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110327504 (Limd1)
   04392 Hippo signaling pathway - multiple species
    110327504 (Limd1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mpah03019]
    110327504 (Limd1)
   03036 Chromosome and associated proteins [BR:mpah03036]
    110327504 (Limd1)
Messenger RNA biogenesis [BR:mpah03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     110327504 (Limd1)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     110327504 (Limd1)
SSDB
Motif
Pfam: LIM
Other DBs
NCBI-GeneID: 110327504
NCBI-ProteinID: XP_021062223
Ensembl: MGP_PahariEiJ_G0015725
LinkDB
Position
10
AA seq 667 aa
MDKYDDLGLEASKFIEDLNMYEASKDGLFRVDKGAGNNPEFEETRRVFATKMAKIHLQQQ
QQQQLLQEEALSRAGRSPVDGGNRQGASSKLAADGAAKPPLAVPTVAPVLATTTAAAQPS
YPSQEQRSRPSAHGARPGSQSCGSREGPVSSQRPALHGLGPSCEDPSCLTHGDYYDNFSL
ASPQWGDKPEGCPSMSLGVGSGWPGCPGNDSTLPRSCGDRHPYQPQLSVCSGRSFESGIS
GQDGGIGGHSSEKPTGLWSTASSQRVNLGFSSMGLENGTSAQPKGTTVSAPMVPSSANQG
TCPKRDSVLRYEASGRVFKPLVDTQPWLQDGPKSYLSVSAPLSSTAGKDSAQSGVTTGLD
PKFGCVESGTSPKPSPTRNVHPVMSTPSELSCKESPPSWSTDSSLEPVLPESPTPSRVRL
PCQTLAPGPELGPSPAELKLEALTQRLEREMDAHPKADYFGSCVKCNKGVFGAGQACQAM
GDLYHDACFTCAACSRKLRGKAFYFVNGKVFCEEDFLYSGFQQSADRCFLCGHLIMDMIL
QALGKSYHPGCFRCVICNECLDGVPFTVDSENKIYCVRDYHKVLAPKCAACGLPILPPEG
SDETIRVVSMDRDYHVECYHCEDCGLELNDEDGHRCYPLEDHLFCHSCHVKRLEKGPSPA
PLHQHHI
NT seq 2004 nt   +upstreamnt  +downstreamnt
atggataaatacgatgatctgggccttgaggccagtaagttcatcgaggacctgaacatg
tatgaggcctccaaggatgggctcttccgggtggacaagggtgctggcaacaacccagaa
tttgaggaaactcgaagggtgttcgcgaccaagatggccaaaatccacctccagcagcag
caacagcagcagctcctacaggaggaggccctatccagggcaggcagaagccctgtcgac
ggtgggaaccgtcagggtgcgagcagcaagctggctgcagatggggccgcaaagcctcct
ctggctgtgccaacagtggcacctgtattagctaccaccactgcggccgcgcagccctca
tacccatctcaggagcagaggtccaggccgtctgcccatggcgcaaggcctggcagtcag
agctgtggttccagggaaggacctgtgagttcccagagacctgctttacacggtctgggt
ccctcctgtgaagacccttcctgcctcactcacggggactattatgacaatttctctttg
gcaagcccacagtggggtgataaaccagaagggtgccccagcatgagtctgggtgtaggg
agtggatggcctggttgcccagggaatgactccacattgcccagatcctgtggagatcgg
cacccttaccagccgcagctctccgtgtgctctggcaggtcttttgaaagtggcatcagt
ggccaggacggtggcattggtggccatagcagtgagaagccgacaggcctttggtccact
gcctcctctcagcgagtgaacctcggcttttcttccatgggcttggagaatgggacctcc
gctcaacccaagggcacaactgtttcagcaccgatggtccctagcagcgccaaccaagga
acttgtccgaaaagagattcagttctgagatatgaggcttcaggcagggtcttcaaaccc
cttgtggacactcagccttggctccaggatgggcccaagtcttacctctctgtttctgct
ccactatcctcaacagctggcaaggacagtgcccagtcaggtgtgaccaccgggctggat
cctaagtttggatgcgtggagtctggcactagtcccaagcccagccccaccagaaacgtc
catccggtaatgtccactccatctgagttatcttgtaaagagagtcctcccagctggtcc
actgacagtagcctggaacctgtgctcccagagagccccaccccctccagggtgagattg
ccctgccagaccctcgcgccaggccctgagcttggaccctcccctgcggaattgaagttg
gaagccctcacccagcgtctggagcgagagatggatgctcaccccaaagcggactacttc
ggttcctgtgtgaaatgcaacaaaggggtgtttggagctggccaggcctgtcaggccatg
ggagatctctaccacgatgcatgcttcacttgtgcagcctgcagcaggaagttaagagga
aaggccttctactttgtcaacggcaaagtattctgtgaggaagactttttgtattctggc
tttcagcagtctgcagacaggtgttttctttgtggacacctgatcatggacatgatccta
caggccctagggaagtcctatcaccccggctgtttccgctgcgtcatctgtaatgaatgt
ctagatggggttcctttcaccgtggactctgagaacaagatctactgtgtccgagactat
cacaaggtgctggcccccaagtgtgcagcctgtggccttcccatccttccaccagagggt
tcagatgagaccatcagagttgtgtccatggacagagactaccacgtagagtgctaccac
tgtgaggactgtggtctggagctcaatgatgaggacggtcaccgctgctatccactggag
gaccacctgttctgtcactcctgccatgtcaagagactggagaaaggaccctcacctgca
cccctccaccagcaccacatctag

KEGG   Mus pahari (shrew mouse): 110328413
Entry
110328413         CDS       T05929                                 

Gene name
Wtip
Definition
(RefSeq) Wilms tumor protein 1-interacting protein
  KO
K16682  LIM domain-containing protein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
mpah04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110328413 (Wtip)
   04392 Hippo signaling pathway - multiple species
    110328413 (Wtip)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mpah03019]
    110328413 (Wtip)
   03036 Chromosome and associated proteins [BR:mpah03036]
    110328413 (Wtip)
Messenger RNA biogenesis [BR:mpah03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     110328413 (Wtip)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     110328413 (Wtip)
SSDB
Motif
Pfam: LIM
Other DBs
NCBI-GeneID: 110328413
NCBI-ProteinID: XP_021063483
Ensembl: MGP_PahariEiJ_G0012803
LinkDB
Position
1
AA seq 398 aa
MQRSRTAADDAALLLAGLGLREPEPTAGSPGRVRRGPRAVDEAAPASGRRGKGGGIGPEA
APDVPSRPERGPRASLAGSDGGSARSSGISLGYDQRHGHGPGPPSGGSARSSVSSLGSRG
SAGACADLLPPGVGPAPARSPEPAQFPFPLPSLPLPPGREGGPSAAERRLEALTRELERA
LEARTARDYFGICIKCGLGIYGARQACQAMGSLYHTDCFICDSCGRRLRGKAFYNVGEKV
YCQEDFLYSGFQQTADKCSVCGHLIMEMILQALGKSYHPGCFRCSVCNECLDGVPFTVDV
ENNIYCVRDYHTVFAPKCASCARPILPAQGCETTIRVVSMDRDYHVECYHCEDCGLQLSG
EEGRRCYPLEGHLLCRRCHLRRLGQGPLPSPAVHVTEL
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgcagcgctcgcggacggccgcggacgacgcggctctgctcctggccgggctgggcctg
cgcgagccggagccgaccgccggctccccagggcgcgtgcggcgcgggccgagggccgtg
gacgaggcggcgcccgcgtcgggccgccgaggcaagggcggcggcatcggacccgaggcc
gcgcccgacgtcccgagccgccccgagcgaggcccgcgcgccagcctggcgggctcggac
ggcggcagcgcgcgctcgagcggtatcagcctgggctacgaccagcgccacggccacggc
cccgggccgccgtcggggggcagcgcgcgctccagcgtgtccagcctgggctcccgtggc
tcagcgggcgcctgtgcagacctgctgccgcccggcgtcggccccgcgcccgcccgctct
ccggagcctgcccagtttcccttcccgttgccgtcgctgccgctgcccccgggccgggag
ggcggcccgagtgcggccgagcggcggctggaggcgctcacgcgggaactggagcgcgcg
ctcgaggcgcgcacggcgcgagactactttggcatttgtatcaagtgtggcctcggcatc
tacggagcgaggcaggcgtgccaggcgatggggagcctgtatcacaccgactgcttcatc
tgtgactcctgcgggagacggctccgtgggaaggccttctataacgtgggtgagaaagtg
tactgccaggaggacttcctgtactccgggttccagcaaacagctgacaagtgtagcgtg
tgtggacacctcatcatggagatgattctgcaggcccttggcaagtcctaccacccgggc
tgcttccgctgctcagtgtgcaacgagtgcttggatggggttccctttactgtggatgtg
gagaacaacatttactgtgttagagattatcatacggtgtttgcaccaaaatgtgcctcc
tgtgcccgccccatcctccctgcacagggctgtgagacaaccattcgtgtggtgtccatg
gacagagactaccatgtggagtgttaccactgtgaggactgtgggctgcagctgagcggg
gaggagggacgccgctgctaccccctggaggggcacctgctctgccgtcgatgccacctg
aggcgccttggacagggcccactcccctcgcctgctgtgcatgtgactgagctctga

DBGET integrated database retrieval system