KEGG   Mus pahari (shrew mouse): 110325466
Entry
110325466         CDS       T05929                                 

Gene name
Mapk8
Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01522  Endocrine resistance
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04024  cAMP signaling pathway
mpah04068  FoxO signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04137  Mitophagy - animal
mpah04140  Autophagy - animal
mpah04141  Protein processing in endoplasmic reticulum
mpah04210  Apoptosis
mpah04215  Apoptosis - multiple species
mpah04217  Necroptosis
mpah04310  Wnt signaling pathway
mpah04380  Osteoclast differentiation
mpah04510  Focal adhesion
mpah04530  Tight junction
mpah04620  Toll-like receptor signaling pathway
mpah04621  NOD-like receptor signaling pathway
mpah04622  RIG-I-like receptor signaling pathway
mpah04625  C-type lectin receptor signaling pathway
mpah04657  IL-17 signaling pathway
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04660  T cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04668  TNF signaling pathway
mpah04722  Neurotrophin signaling pathway
mpah04723  Retrograde endocannabinoid signaling
mpah04728  Dopaminergic synapse
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04910  Insulin signaling pathway
mpah04912  GnRH signaling pathway
mpah04914  Progesterone-mediated oocyte maturation
mpah04917  Prolactin signaling pathway
mpah04920  Adipocytokine signaling pathway
mpah04926  Relaxin signaling pathway
mpah04930  Type II diabetes mellitus
mpah04931  Insulin resistance
mpah04932  Non-alcoholic fatty liver disease
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04935  Growth hormone synthesis, secretion and action
mpah05010  Alzheimer disease
mpah05012  Parkinson disease
mpah05016  Huntington disease
mpah05017  Spinocerebellar ataxia
mpah05020  Prion disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05132  Salmonella infection
mpah05133  Pertussis
mpah05135  Yersinia infection
mpah05142  Chagas disease
mpah05145  Toxoplasmosis
mpah05152  Tuberculosis
mpah05161  Hepatitis B
mpah05162  Measles
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05210  Colorectal cancer
mpah05212  Pancreatic cancer
mpah05231  Choline metabolism in cancer
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110325466 (Mapk8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110325466 (Mapk8)
   04012 ErbB signaling pathway
    110325466 (Mapk8)
   04014 Ras signaling pathway
    110325466 (Mapk8)
   04310 Wnt signaling pathway
    110325466 (Mapk8)
   04668 TNF signaling pathway
    110325466 (Mapk8)
   04068 FoxO signaling pathway
    110325466 (Mapk8)
   04071 Sphingolipid signaling pathway
    110325466 (Mapk8)
   04024 cAMP signaling pathway
    110325466 (Mapk8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110325466 (Mapk8)
   04137 Mitophagy - animal
    110325466 (Mapk8)
  09143 Cell growth and death
   04210 Apoptosis
    110325466 (Mapk8)
   04215 Apoptosis - multiple species
    110325466 (Mapk8)
   04217 Necroptosis
    110325466 (Mapk8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110325466 (Mapk8)
   04530 Tight junction
    110325466 (Mapk8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110325466 (Mapk8)
   04621 NOD-like receptor signaling pathway
    110325466 (Mapk8)
   04622 RIG-I-like receptor signaling pathway
    110325466 (Mapk8)
   04625 C-type lectin receptor signaling pathway
    110325466 (Mapk8)
   04660 T cell receptor signaling pathway
    110325466 (Mapk8)
   04658 Th1 and Th2 cell differentiation
    110325466 (Mapk8)
   04659 Th17 cell differentiation
    110325466 (Mapk8)
   04657 IL-17 signaling pathway
    110325466 (Mapk8)
   04664 Fc epsilon RI signaling pathway
    110325466 (Mapk8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110325466 (Mapk8)
   04920 Adipocytokine signaling pathway
    110325466 (Mapk8)
   04912 GnRH signaling pathway
    110325466 (Mapk8)
   04914 Progesterone-mediated oocyte maturation
    110325466 (Mapk8)
   04917 Prolactin signaling pathway
    110325466 (Mapk8)
   04926 Relaxin signaling pathway
    110325466 (Mapk8)
   04935 Growth hormone synthesis, secretion and action
    110325466 (Mapk8)
  09156 Nervous system
   04728 Dopaminergic synapse
    110325466 (Mapk8)
   04723 Retrograde endocannabinoid signaling
    110325466 (Mapk8)
   04722 Neurotrophin signaling pathway
    110325466 (Mapk8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110325466 (Mapk8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110325466 (Mapk8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110325466 (Mapk8)
   05231 Choline metabolism in cancer
    110325466 (Mapk8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110325466 (Mapk8)
   05212 Pancreatic cancer
    110325466 (Mapk8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110325466 (Mapk8)
   05012 Parkinson disease
    110325466 (Mapk8)
   05016 Huntington disease
    110325466 (Mapk8)
   05017 Spinocerebellar ataxia
    110325466 (Mapk8)
   05020 Prion disease
    110325466 (Mapk8)
   05022 Pathways of neurodegeneration - multiple diseases
    110325466 (Mapk8)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110325466 (Mapk8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110325466 (Mapk8)
   04932 Non-alcoholic fatty liver disease
    110325466 (Mapk8)
   04931 Insulin resistance
    110325466 (Mapk8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110325466 (Mapk8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110325466 (Mapk8)
   05135 Yersinia infection
    110325466 (Mapk8)
   05133 Pertussis
    110325466 (Mapk8)
   05152 Tuberculosis
    110325466 (Mapk8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110325466 (Mapk8)
   05170 Human immunodeficiency virus 1 infection
    110325466 (Mapk8)
   05161 Hepatitis B
    110325466 (Mapk8)
   05171 Coronavirus disease - COVID-19
    110325466 (Mapk8)
   05162 Measles
    110325466 (Mapk8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110325466 (Mapk8)
   05169 Epstein-Barr virus infection
    110325466 (Mapk8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110325466 (Mapk8)
   05142 Chagas disease
    110325466 (Mapk8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110325466 (Mapk8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110325466 (Mapk8)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     110325466 (Mapk8)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   110325466 (Mapk8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2 DUF530
Other DBs
NCBI-GeneID: 110325466
NCBI-ProteinID: XP_021059138
Ensembl: MGP_PahariEiJ_G0030120
LinkDB
Position
8
AA seq 427 aa
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAMINGSQHPSSSPSVNDMSSMSTDPTLASDTDSSLEASA
GPLGCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcagaagcaaacgtgacaacaatttttatagtgtagagattggagattctacattc
acagttctaaaacgataccagaatttaaagcctataggctcaggagctcaaggaatagtg
tgtgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctcagccggcca
tttcagaatcagacccatgctaagcgcgcctaccgagaactagttcttatgaagtgtgtt
aatcacaaaaatataattggccttttgaatgttttcacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcag
atggagttagatcatgaaagaatgtcctaccttctctatcaaatgctgtgtggaatcaag
caccttcactctgctggaattattcatcgggacttaaagcctagtaatatagtagtcaaa
tcagactgcactttgaagattcttgattttggactggcgaggactgcaggaacgagtttt
atgatgacgccttacgtggtgactcgctactacagagcaccagaggtcattctcggcatg
ggctacaaggagaacgtggatttatggtctgtggggtgcattatgggagaaatggtttgc
cacaaaatcctctttccaggaagggactatattgatcagtggaataaagttattgaacag
ctcggaacaccttgtcctgaattcatgaagaaactacaaccaacagtaaggacttatgtt
gaaaacaggcctaaatatgccggatatagctttgagaaactattccctgatgtgcttttc
ccagctgactcagagcataacaaacttaaagccagtcaggcaagagatttgttatccaaa
atgctagtaatagacgcatccaaaaggatctccgtagatgaagctctccagcacccatac
atcaatgtctggtatgacccttcagaagcagaagccccgccaccaaagatccctgacaag
cagttagatgaaagggagcacacaatcgaggagtggaaagaactgatatacaaggaggta
atggatttggaggaacgaactaagaatggagtcataagagggcagccatctcctttaggt
gcagcaatgatcaatggctctcagcatccatcgtcttcgccgtctgtcaatgacatgtct
tcaatgtccacagatccgactttggcctcggatacagacagcagtctagaagcatcagct
ggacctctgggctgctgtagatga

KEGG   Mus pahari (shrew mouse): 110330449
Entry
110330449         CDS       T05929                                 

Gene name
Mapk10
Definition
(RefSeq) mitogen-activated protein kinase 10 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01522  Endocrine resistance
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04024  cAMP signaling pathway
mpah04068  FoxO signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04137  Mitophagy - animal
mpah04140  Autophagy - animal
mpah04141  Protein processing in endoplasmic reticulum
mpah04210  Apoptosis
mpah04215  Apoptosis - multiple species
mpah04217  Necroptosis
mpah04310  Wnt signaling pathway
mpah04380  Osteoclast differentiation
mpah04510  Focal adhesion
mpah04530  Tight junction
mpah04620  Toll-like receptor signaling pathway
mpah04621  NOD-like receptor signaling pathway
mpah04622  RIG-I-like receptor signaling pathway
mpah04625  C-type lectin receptor signaling pathway
mpah04657  IL-17 signaling pathway
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04660  T cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04668  TNF signaling pathway
mpah04722  Neurotrophin signaling pathway
mpah04723  Retrograde endocannabinoid signaling
mpah04728  Dopaminergic synapse
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04910  Insulin signaling pathway
mpah04912  GnRH signaling pathway
mpah04914  Progesterone-mediated oocyte maturation
mpah04917  Prolactin signaling pathway
mpah04920  Adipocytokine signaling pathway
mpah04926  Relaxin signaling pathway
mpah04930  Type II diabetes mellitus
mpah04931  Insulin resistance
mpah04932  Non-alcoholic fatty liver disease
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04935  Growth hormone synthesis, secretion and action
mpah05010  Alzheimer disease
mpah05012  Parkinson disease
mpah05016  Huntington disease
mpah05017  Spinocerebellar ataxia
mpah05020  Prion disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05132  Salmonella infection
mpah05133  Pertussis
mpah05135  Yersinia infection
mpah05142  Chagas disease
mpah05145  Toxoplasmosis
mpah05152  Tuberculosis
mpah05161  Hepatitis B
mpah05162  Measles
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05210  Colorectal cancer
mpah05212  Pancreatic cancer
mpah05231  Choline metabolism in cancer
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110330449 (Mapk10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110330449 (Mapk10)
   04012 ErbB signaling pathway
    110330449 (Mapk10)
   04014 Ras signaling pathway
    110330449 (Mapk10)
   04310 Wnt signaling pathway
    110330449 (Mapk10)
   04668 TNF signaling pathway
    110330449 (Mapk10)
   04068 FoxO signaling pathway
    110330449 (Mapk10)
   04071 Sphingolipid signaling pathway
    110330449 (Mapk10)
   04024 cAMP signaling pathway
    110330449 (Mapk10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110330449 (Mapk10)
   04137 Mitophagy - animal
    110330449 (Mapk10)
  09143 Cell growth and death
   04210 Apoptosis
    110330449 (Mapk10)
   04215 Apoptosis - multiple species
    110330449 (Mapk10)
   04217 Necroptosis
    110330449 (Mapk10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110330449 (Mapk10)
   04530 Tight junction
    110330449 (Mapk10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110330449 (Mapk10)
   04621 NOD-like receptor signaling pathway
    110330449 (Mapk10)
   04622 RIG-I-like receptor signaling pathway
    110330449 (Mapk10)
   04625 C-type lectin receptor signaling pathway
    110330449 (Mapk10)
   04660 T cell receptor signaling pathway
    110330449 (Mapk10)
   04658 Th1 and Th2 cell differentiation
    110330449 (Mapk10)
   04659 Th17 cell differentiation
    110330449 (Mapk10)
   04657 IL-17 signaling pathway
    110330449 (Mapk10)
   04664 Fc epsilon RI signaling pathway
    110330449 (Mapk10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110330449 (Mapk10)
   04920 Adipocytokine signaling pathway
    110330449 (Mapk10)
   04912 GnRH signaling pathway
    110330449 (Mapk10)
   04914 Progesterone-mediated oocyte maturation
    110330449 (Mapk10)
   04917 Prolactin signaling pathway
    110330449 (Mapk10)
   04926 Relaxin signaling pathway
    110330449 (Mapk10)
   04935 Growth hormone synthesis, secretion and action
    110330449 (Mapk10)
  09156 Nervous system
   04728 Dopaminergic synapse
    110330449 (Mapk10)
   04723 Retrograde endocannabinoid signaling
    110330449 (Mapk10)
   04722 Neurotrophin signaling pathway
    110330449 (Mapk10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110330449 (Mapk10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110330449 (Mapk10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110330449 (Mapk10)
   05231 Choline metabolism in cancer
    110330449 (Mapk10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110330449 (Mapk10)
   05212 Pancreatic cancer
    110330449 (Mapk10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110330449 (Mapk10)
   05012 Parkinson disease
    110330449 (Mapk10)
   05016 Huntington disease
    110330449 (Mapk10)
   05017 Spinocerebellar ataxia
    110330449 (Mapk10)
   05020 Prion disease
    110330449 (Mapk10)
   05022 Pathways of neurodegeneration - multiple diseases
    110330449 (Mapk10)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110330449 (Mapk10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110330449 (Mapk10)
   04932 Non-alcoholic fatty liver disease
    110330449 (Mapk10)
   04931 Insulin resistance
    110330449 (Mapk10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110330449 (Mapk10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110330449 (Mapk10)
   05135 Yersinia infection
    110330449 (Mapk10)
   05133 Pertussis
    110330449 (Mapk10)
   05152 Tuberculosis
    110330449 (Mapk10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110330449 (Mapk10)
   05170 Human immunodeficiency virus 1 infection
    110330449 (Mapk10)
   05161 Hepatitis B
    110330449 (Mapk10)
   05171 Coronavirus disease - COVID-19
    110330449 (Mapk10)
   05162 Measles
    110330449 (Mapk10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110330449 (Mapk10)
   05169 Epstein-Barr virus infection
    110330449 (Mapk10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110330449 (Mapk10)
   05142 Chagas disease
    110330449 (Mapk10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110330449 (Mapk10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110330449 (Mapk10)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     110330449 (Mapk10)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   110330449 (Mapk10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 110330449
NCBI-ProteinID: XP_021066206
Ensembl: MGP_PahariEiJ_G0017243
LinkDB
Position
13
AA seq 494 aa
MGDTGVSGATVKEMARVMRMAEVTEDGRVFMSLHFLYYCSEPTLDVKIAFCQGFDKHVDV
SSIAKHYNMSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNV
AIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMD
ANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGL
ARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYID
QWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKAS
QARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEW
KELIYKEVMNSEEKTKNGVVKGQPSPSGAAVNSSESLPPSSSVNDISSMSTDQTLASDTD
SSLEASAGPLGCCR
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgggagatacaggggtttccggtgccaccgtgaaggagatggctcgggtgatgagaatg
gctgaagtcactgaggatggcagggtatttatgagcctccatttcttatactactgcagt
gaaccaaccttggatgtgaaaattgccttttgtcagggattcgataaacacgtggatgtg
tcatctattgccaaacattacaacatgagcaaaagcaaggtggacaaccagttctacagt
gtggaagtgggggactcaaccttcaccgttcttaagcgctaccagaacctgaagccgatt
ggctctggggctcagggaatagtttgtgctgcgtatgacgctgtcctcgacagaaatgtg
gccattaagaagctcagcagacccttccagaaccaaactcacgccaagagggcttaccgg
gagctggtcctcatgaagtgtgtgaaccataaaaacattattagcttattaaatgttttt
acaccccagaaaacactggaggagttccaagatgtctacttagtgatggaactgatggat
gccaacttgtgtcaggtgattcagatggagctggaccacgagcggatgtcttacttgctg
taccagatgctgtgtggcatcaagcatctgcactccgctgggatcatccacagggactta
aaacccagtaacattgtagtcaagtctgattgcacactgaaaatcctcgacttcggactg
gccaggacagcgggcacaagcttcatgatgactccgtatgtggtgacgcgatattacaga
gcccctgaggtcatcctgggcatgggctacaaggagaacgtggacatatggtctgtggga
tgcatcatgggagaaatggtccgccacaaaatcctctttcccggaagggactatattgac
cagtggaacaaagtcatcgagcagctaggaactccgtgtccagagttcatgaagaaattg
cagcccacagtcagaaactacgtggagaatcggcccaagtacgcaggactcaccttcccc
aagctctttccagattccctcttcccagcggattctgagcacaataaacttaaagccagc
caagccagggatttgttgtctaagatgttagtgattgacccagcgaagaggatatcggtg
gacgacgcactgcagcatccgtacattaacgtttggtacgacccggctgaagtggaggcg
cctccacctcagatatacgataagcagctggatgaaagggagcacaccatcgaagagtgg
aaagagcttatctacaaggaggtaatgaactcagaagagaagactaagaacggcgtagtc
aaaggccagccctcaccttcaggtgcagcagtgaacagcagtgagagtctccctccatcc
tcgtctgtcaatgacatctcctccatgtccaccgaccagaccctcgcatccgacactgac
agcagcctggaggcctcggcgggaccgttgggttgttgcaggtga

KEGG   Mus pahari (shrew mouse): 110332652
Entry
110332652         CDS       T05929                                 

Gene name
Mapk9
Definition
(RefSeq) mitogen-activated protein kinase 9 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01522  Endocrine resistance
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04024  cAMP signaling pathway
mpah04068  FoxO signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04137  Mitophagy - animal
mpah04140  Autophagy - animal
mpah04141  Protein processing in endoplasmic reticulum
mpah04210  Apoptosis
mpah04215  Apoptosis - multiple species
mpah04217  Necroptosis
mpah04310  Wnt signaling pathway
mpah04380  Osteoclast differentiation
mpah04510  Focal adhesion
mpah04530  Tight junction
mpah04620  Toll-like receptor signaling pathway
mpah04621  NOD-like receptor signaling pathway
mpah04622  RIG-I-like receptor signaling pathway
mpah04625  C-type lectin receptor signaling pathway
mpah04657  IL-17 signaling pathway
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04660  T cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04668  TNF signaling pathway
mpah04722  Neurotrophin signaling pathway
mpah04723  Retrograde endocannabinoid signaling
mpah04728  Dopaminergic synapse
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04910  Insulin signaling pathway
mpah04912  GnRH signaling pathway
mpah04914  Progesterone-mediated oocyte maturation
mpah04917  Prolactin signaling pathway
mpah04920  Adipocytokine signaling pathway
mpah04926  Relaxin signaling pathway
mpah04930  Type II diabetes mellitus
mpah04931  Insulin resistance
mpah04932  Non-alcoholic fatty liver disease
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04935  Growth hormone synthesis, secretion and action
mpah05010  Alzheimer disease
mpah05012  Parkinson disease
mpah05016  Huntington disease
mpah05017  Spinocerebellar ataxia
mpah05020  Prion disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05132  Salmonella infection
mpah05133  Pertussis
mpah05135  Yersinia infection
mpah05142  Chagas disease
mpah05145  Toxoplasmosis
mpah05152  Tuberculosis
mpah05161  Hepatitis B
mpah05162  Measles
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05210  Colorectal cancer
mpah05212  Pancreatic cancer
mpah05231  Choline metabolism in cancer
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110332652 (Mapk9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110332652 (Mapk9)
   04012 ErbB signaling pathway
    110332652 (Mapk9)
   04014 Ras signaling pathway
    110332652 (Mapk9)
   04310 Wnt signaling pathway
    110332652 (Mapk9)
   04668 TNF signaling pathway
    110332652 (Mapk9)
   04068 FoxO signaling pathway
    110332652 (Mapk9)
   04071 Sphingolipid signaling pathway
    110332652 (Mapk9)
   04024 cAMP signaling pathway
    110332652 (Mapk9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110332652 (Mapk9)
   04137 Mitophagy - animal
    110332652 (Mapk9)
  09143 Cell growth and death
   04210 Apoptosis
    110332652 (Mapk9)
   04215 Apoptosis - multiple species
    110332652 (Mapk9)
   04217 Necroptosis
    110332652 (Mapk9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110332652 (Mapk9)
   04530 Tight junction
    110332652 (Mapk9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110332652 (Mapk9)
   04621 NOD-like receptor signaling pathway
    110332652 (Mapk9)
   04622 RIG-I-like receptor signaling pathway
    110332652 (Mapk9)
   04625 C-type lectin receptor signaling pathway
    110332652 (Mapk9)
   04660 T cell receptor signaling pathway
    110332652 (Mapk9)
   04658 Th1 and Th2 cell differentiation
    110332652 (Mapk9)
   04659 Th17 cell differentiation
    110332652 (Mapk9)
   04657 IL-17 signaling pathway
    110332652 (Mapk9)
   04664 Fc epsilon RI signaling pathway
    110332652 (Mapk9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110332652 (Mapk9)
   04920 Adipocytokine signaling pathway
    110332652 (Mapk9)
   04912 GnRH signaling pathway
    110332652 (Mapk9)
   04914 Progesterone-mediated oocyte maturation
    110332652 (Mapk9)
   04917 Prolactin signaling pathway
    110332652 (Mapk9)
   04926 Relaxin signaling pathway
    110332652 (Mapk9)
   04935 Growth hormone synthesis, secretion and action
    110332652 (Mapk9)
  09156 Nervous system
   04728 Dopaminergic synapse
    110332652 (Mapk9)
   04723 Retrograde endocannabinoid signaling
    110332652 (Mapk9)
   04722 Neurotrophin signaling pathway
    110332652 (Mapk9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110332652 (Mapk9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110332652 (Mapk9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110332652 (Mapk9)
   05231 Choline metabolism in cancer
    110332652 (Mapk9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110332652 (Mapk9)
   05212 Pancreatic cancer
    110332652 (Mapk9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110332652 (Mapk9)
   05012 Parkinson disease
    110332652 (Mapk9)
   05016 Huntington disease
    110332652 (Mapk9)
   05017 Spinocerebellar ataxia
    110332652 (Mapk9)
   05020 Prion disease
    110332652 (Mapk9)
   05022 Pathways of neurodegeneration - multiple diseases
    110332652 (Mapk9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110332652 (Mapk9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110332652 (Mapk9)
   04932 Non-alcoholic fatty liver disease
    110332652 (Mapk9)
   04931 Insulin resistance
    110332652 (Mapk9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110332652 (Mapk9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110332652 (Mapk9)
   05135 Yersinia infection
    110332652 (Mapk9)
   05133 Pertussis
    110332652 (Mapk9)
   05152 Tuberculosis
    110332652 (Mapk9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110332652 (Mapk9)
   05170 Human immunodeficiency virus 1 infection
    110332652 (Mapk9)
   05161 Hepatitis B
    110332652 (Mapk9)
   05171 Coronavirus disease - COVID-19
    110332652 (Mapk9)
   05162 Measles
    110332652 (Mapk9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110332652 (Mapk9)
   05169 Epstein-Barr virus infection
    110332652 (Mapk9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110332652 (Mapk9)
   05142 Chagas disease
    110332652 (Mapk9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110332652 (Mapk9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110332652 (Mapk9)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     110332652 (Mapk9)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   110332652 (Mapk9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo RIO1 APH Kinase-like FTA2
Other DBs
NCBI-GeneID: 110332652
NCBI-ProteinID: XP_021069613
Ensembl: MGP_PahariEiJ_G0017415
LinkDB
Position
14
AA seq 423 aa
MSDSKSDGQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGIKDQPSDAAVSSKATPSQSSSINDISSMSTEHTLASDTDSSLDASTGPLE
GCR
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgagtgacagtaaaagcgatggtcagttttacagtgtgcaggtggcggactcgactttc
actgttctaaaacgttaccagcaactgaaaccgatcggctctggagcccaagggattgtc
tgtgctgcttttgatacagttcttgggataaatgtggctgtcaagaagttaagtcgtcct
tttcagaaccaaacacacgcaaagagagcctaccgcgaactcgtcctcttaaagtgtgtc
aatcataaaaacataattagcttgttaaatgtgttcacaccacaaaaaacgctagaagaa
tttcaagatgtgtacttggttatggaattgatggatgctaacttatgtcaggttattcat
atggagctggaccatgaaagaatgtcataccttctctaccagatgctatgtggcattaag
catctgcactcagctggtataattcatagagatttgaagcctagcaacattgtagtaaaa
tcagactgcactctcaagatccttgactttggcctggcacgaacagcttgtaccaacttt
atgatgactccctatgtggtaactcgctactatcgggctccagaagtcatcctgggcatg
ggctacaaagagaatgttgatatctggtcagtgggttgcatcatgggagagctggtgaaa
ggttgtgtgatattccaaggtactgaccatattgatcaatggaataaagttattgaacag
ctaggaacaccatccgcagagttcatgaagaaacttcagccaactgtaaggaattacgtg
gaaaacagaccaaagtaccctggaatcaagtttgaagagctctttccagattggatattt
ccatcagagtctgagagagacaaaataaaaacaagtcaagccagagatctgttatcgaaa
atgttagtgattgatccagacaagcggatctctgtggacgaagccttgcgccacccgtat
attactgtttggtatgaccccgctgaagcagaagcgccaccacctcaaatttatgatgcc
cagttggaagaaagagagcatgcaattgaagagtggaaagaactaatttacaaagaagtg
atggactgggaagaaagaagcaagaatggcataaaagaccagccttcagatgcagcagta
agtagcaaggccactccttctcagtcgtcatccatcaatgacatctcctccatgtccact
gagcacaccctggcctcggacacagacagcagcctcgatgcctcaacaggacccctggaa
ggctgccgatga

DBGET integrated database retrieval system