KEGG   Mus pahari (shrew mouse): 110325522
Entry
110325522         CDS       T05929                                 

Gene name
Socs4
Definition
(RefSeq) suppressor of cytokine signaling 4
  KO
K04697  suppressor of cytokine signaling 4
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04630  JAK-STAT signaling pathway
mpah04910  Insulin signaling pathway
mpah04917  Prolactin signaling pathway
mpah04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110325522 (Socs4)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110325522 (Socs4)
   04917 Prolactin signaling pathway
    110325522 (Socs4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110325522 (Socs4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110325522 (Socs4)
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     110325522 (Socs4)
SSDB
Motif
Pfam: SOCS SOCS_box SH2
Other DBs
NCBI-GeneID: 110325522
NCBI-ProteinID: XP_021059218
Ensembl: MGP_PahariEiJ_G0030181
LinkDB
Position
8
AA seq 436 aa
MAENNSKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESCSESEAMGTVENVQIPLR
SQERQLSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSGRHSPGLPSKRKIH
ISELMLDKCPFPPRSDLAFRWHFIKRHTVPISPNSDEWVSADLSESKLRDAQLKRRNTED
DIPCFSHTSVQPCVITTNSASCTGGHITGSMMNLVTNNSIEDSDMDSEDEIITLCTSSRK
RNKPRWEMEDEILQLEAPPKFHTQIDYVHCLVPDLLQISNNPCYWGVMDKYAAEALLEGK
PEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGLLEH
YKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSPMKLYLKEYH
YKSKVRLLRIDVPEQQ
NT seq 1311 nt   +upstreamnt  +downstreamnt
atggctgaaaacaatagtaaaaatgtagatgtacggcctaaaacaagtcggagtcgaagt
gctgacaggaaggatggctatgtgtggagtggaaagaagttgtcttggtccaaaaagagt
gagagttgttctgaatctgaagccatgggtactgttgagaatgttcaaattcctctaagg
agccaagaaaggcagcttagctgttcgtccattgagttggacttagatcattcctgtgga
catagatttttaggccgatcccttaaacagaaactgcaagatgccgtggggcagtgtttt
ccaataaagaattgtagtggccgacactctccagggcttccatctaaaagaaagattcat
atcagtgaactcatgttagataagtgccctttcccacctcgatcagatttagcctttagg
tggcattttattaaacgacacactgttcctataagtcccaattcagatgaatgggtgagt
gcagacctatctgagagtaaattgagagatgctcagctgaaacgaagaaacacagaagat
gacataccctgcttctcacataccagtgtccagccttgtgtcataactaccaacagtgct
tcgtgtacaggtggtcacataactggttctatgatgaacttggtcacaaacaacagcata
gaagacagtgatatggattcagaagatgaaattataacactgtgcacaagctccagaaaa
aggaacaagcccaggtgggaaatggaagatgaaatcctgcagttggaggcacctcctaag
ttccacacccagatcgactacgtccactgccttgttccggacctccttcagatcagtaac
aatccatgctactggggtgtcatggataaatacgcagccgaagcactgctggaaggaaag
ccagagggcacctttttacttcgagattcagcacaggaagattatttattctctgttagt
tttagacgctatagtcgttctcttcatgctagaattgaacaatggaatcataattttagc
tttgatgcccatgatccttgtgtcttccattctcctgatattactgggctcctagaacat
tataaggacccaagtgcctgtatgttctttgaaccacttttgtccacccccttaatccgg
actttccccttttccttgcagcatatttgcagaacggttatttgtaattgtacgacttat
gatggcatcgatgcccttccaattccttcgcctatgaaattgtatctgaaggaataccac
tataaatcaaaagttaggttactcaggattgatgtgccagagcagcagtga

KEGG   Mus pahari (shrew mouse): 110326628
Entry
110326628         CDS       T05929                                 

Gene name
Socs2
Definition
(RefSeq) suppressor of cytokine signaling 2 isoform X1
  KO
K04695  suppressor of cytokine signaling 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04630  JAK-STAT signaling pathway
mpah04910  Insulin signaling pathway
mpah04917  Prolactin signaling pathway
mpah04930  Type II diabetes mellitus
mpah04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110326628 (Socs2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110326628 (Socs2)
   04917 Prolactin signaling pathway
    110326628 (Socs2)
   04935 Growth hormone synthesis, secretion and action
    110326628 (Socs2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110326628 (Socs2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110326628 (Socs2)
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     110326628 (Socs2)
SSDB
Motif
Pfam: SH2 SOCS_box SH2_2 Condensation
Other DBs
NCBI-GeneID: 110326628
NCBI-ProteinID: XP_021060855
Ensembl: MGP_PahariEiJ_G0031337
LinkDB
Position
9
AA seq 200 aa
MTLRCLESSGNGADRTRSQWGTAGSPEEQSPEAARLAKALRELSQTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPTLQHFCRLAINKCTGTIWG
LPLPTRLKDYLEEYKFQVPC
NT seq 603 nt   +upstreamnt  +downstreamnt
atgaccctgcggtgcctggagtcctccgggaatggagcggacaggacgcggagccagtgg
gggaccgcggggtcgccggaggaacagtcccccgaggcggcgcggctggcgaaggcccta
cgcgagctcagtcaaacaggatggtactggggaagtatgactgttaatgaagccaaagag
aaattaaaagaggccccagaaggaactttcttgattagagatagttcacattcagactac
ctactaactatatccgttaagacgtcagctggaccgactaacctgcggattgagtaccaa
gatgggaaattcagattggattctatcatatgcgtcaagtccaagctcaaacagtttgac
agtgtggttcatctgattgactactatgtccagatgtgtaaggataaacggacaggccca
gaagccccgcggaatgggaccgttcacctgtacctgaccaaacctctttatacatcagca
ccgactctgcaacatttctgtcgactcgccattaacaaatgtaccggtacgatctgggga
ctgcctttaccaacaagactaaaagattacttggaagaatataaattccaggtaccttgc
tga

KEGG   Mus pahari (shrew mouse): 110329809
Entry
110329809         CDS       T05929                                 

Gene name
Socs1
Definition
(RefSeq) suppressor of cytokine signaling 1
  KO
K04694  suppressor of cytokine signaling 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04120  Ubiquitin mediated proteolysis
mpah04380  Osteoclast differentiation
mpah04630  JAK-STAT signaling pathway
mpah04910  Insulin signaling pathway
mpah04917  Prolactin signaling pathway
mpah04930  Type II diabetes mellitus
mpah04935  Growth hormone synthesis, secretion and action
mpah05145  Toxoplasmosis
mpah05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110329809 (Socs1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110329809 (Socs1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110329809 (Socs1)
   04917 Prolactin signaling pathway
    110329809 (Socs1)
   04935 Growth hormone synthesis, secretion and action
    110329809 (Socs1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110329809 (Socs1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    110329809 (Socs1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110329809 (Socs1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110329809 (Socs1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110329809 (Socs1)
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     110329809 (Socs1)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 110329809
NCBI-ProteinID: XP_021065348
Ensembl: MGP_PahariEiJ_G0016154
LinkDB
Position
12
AA seq 212 aa
MVARNQVAADNAISPAAEPRRRPEPSSSSSSSSPAAPVRPRPCPAVPAPSPGDTHFRTFR
SHSDYRRITRTSALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKM
ASGPTSIRVHFQAGRFHLDGSRETFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCR
QRIVAAVGRENLARIPVNPVLRDYLSSFPFQI
NT seq 639 nt   +upstreamnt  +downstreamnt
atggtagcacgcaaccaggtggcagccgacaatgcgatctccccggcagcagagccccga
cggcggccagagccctcctcatcctcgtcttcgtcctcgccagcggcccccgtgcgtccc
cggccctgcccggcggtcccggccccgtccccgggcgacactcacttccgcaccttccgc
tcccactccgattaccggcgcatcacgcggaccagcgcgctccttgacgcttgcggcttc
tattggggacccctgagcgtgcacggggcgcacgagcggctgcgtgccgagcccgtgggc
accttcttggtgcgcgacagtcgccaacggaactgcttcttcgcgctcagcgtgaagatg
gcttcgggccccacgagcatccgcgtgcacttccaggccggccgcttccacttggacggc
agccgcgagaccttcgactgccttttcgagctgctggagcactacgtggcggcgccgcgc
cgcatgttgggggccccgctgcgccagcgccgcgtgcggccactgcaggagctgtgtcgc
cagcgcatcgtggccgccgtgggtcgcgagaacctggcgcgcatccctgttaacccggta
ctccgtgactacctgagttctttccccttccagatctga

KEGG   Mus pahari (shrew mouse): 110332041
Entry
110332041         CDS       T05929                                 

Gene name
Socs7
Definition
(RefSeq) suppressor of cytokine signaling 7
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04630  JAK-STAT signaling pathway
mpah04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110332041 (Socs7)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    110332041 (Socs7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110332041 (Socs7)
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     110332041 (Socs7)
SSDB
Motif
Pfam: SOCS_box SH2
Other DBs
NCBI-GeneID: 110332041
NCBI-ProteinID: XP_021068646
Ensembl: MGP_PahariEiJ_G0018183
LinkDB
Position
14
AA seq 579 aa
MVFRNVGRPPEEEDAEAAPEPGPSELLCPRHRCALDPKALPPGLALERTWGPVAGLEAQL
AALGLGQPAGPGIKTAGGGCCPCPCPPQPPPPQPPPPAAAPQAGEDPTETSDALLVLEGL
ESEAESLETNSCSEEELSSPGRGGGGVGGRLLLQPPGTELPPVPFPLQDLVPPGRLSRGE
QQQQQPPPPPPPPGPLRPLAGPSRKGSFKIRLSRLFRTKSCNGGSGGGDGTGKRPSGDLA
ASAASLTDMGGSAVRELDAGRKPRLTRTQSAFSPVSFSPLFTGETVSLVDVDISQRGLTS
PHPPTPPPPPRRSLSLLDDISGTLPTSVLVAPMGSSLQSFPLPPPPPPHAPDAFPRIAPI
RASESLHSQPPQHLQCPLYRPDSSSFAASLRELEKCGWYWGPMNWEDAEMKLKGKPDGSF
LVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHS
KNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIPDLPLPK
PLISYIRKFYYYDPQEEVYLSLKEAQLISKQKQEVEPST
NT seq 1740 nt   +upstreamnt  +downstreamnt
atggtgttccgcaacgtggggcggccgccggaggaggaggacgcggaggcggccccggag
ccgggaccctcggaactgctgtgtccccggcaccgctgcgcgctggatcccaaggccctc
ccgccgggcttggcgctcgagcggacctggggtccggtggctggactagaggcgcagctg
gcggcgctggggctcggacagccggcggggccggggatcaagaccgccggcggaggctgc
tgtccgtgcccgtgccccccgcagccgccgccgccgcaacccccgccgcctgctgccgcc
ccgcaggccggggaggaccccacggagacgagcgacgcgctgctggtcctggaaggcttg
gaatcggaggccgagagcctggagactaacagctgctcggaagaggagctcagcagcccc
ggccgtggaggaggaggagtgggtggccggctgcttctgcagcctccgggtaccgaacta
cccccggtgccctttccgctgcaggacttggtccctccagggcgcttgagccgaggggag
cagcagcagcagcaacctcccccaccgccgccgcctcccgggcccctccggcccctcgca
ggcccttctcggaagggctccttcaaaatccgcctcagtcgcctgtttcgcacgaagagc
tgcaacggcggctcgggcggcggggatgggaccggcaagaggccttcgggagatctggca
gcttcagctgcgagcctgacagacatgggaggctctgcggtccgggagctggatgcgggg
aggaaacccaggttgacaagaactcaaagtgccttttccccggtctccttcagccccttg
ttcacaggtgaaacagtatcgcttgtggacgtggacatttctcagcggggcctgacctct
ccacaccctccaactccccctcctcctccgagaagaagcctcagcctcctagatgatatc
agtgggacgctgcctacatctgtccttgtggctccgatggggtcttccttgcagtctttc
cccctacctccgcctcctccaccccacgccccagatgcatttccccgaattgctcccatc
agagcatcagagtccctgcacagccagcccccccagcacctccagtgtcccctctatcgg
cccgactcaagcagctttgcagccagccttcgagagctggaaaagtgtggctggtattgg
ggacctatgaattgggaagatgcagagatgaaactgaaagggaagccagatggctccttc
ctggtacgagacagctctgatcctcgttacatcctgagcctcagcttccgatcgcagggt
atcacccatcacactagaatggagcactatagagggactttcagcttatggtgccatccc
aagtttgaggatcgctgtcagtcagtggtggagttcattaagagagccatcatgcactcc
aagaatgggaaatttctctatttcctgagatccagggtcccaggactgccaccaactcca
gtacagctgctctatccagtgtccagattcagcaatgtcaagtccctccagcatctttgc
agattccggatccggcagcttgtccgaatagatcatattccggatctgccactgcctaaa
cctctgatctcttacattcgaaagttctactattatgatcctcaggaagaggtgtacctg
tccctaaaggaagcgcagctcatttccaaacagaagcaagaggtggagccttccacgtag

KEGG   Mus pahari (shrew mouse): 110332146
Entry
110332146         CDS       T05929                                 

Gene name
Socs3
Definition
(RefSeq) suppressor of cytokine signaling 3
  KO
K04696  suppressor of cytokine signaling 3
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04120  Ubiquitin mediated proteolysis
mpah04380  Osteoclast differentiation
mpah04630  JAK-STAT signaling pathway
mpah04668  TNF signaling pathway
mpah04910  Insulin signaling pathway
mpah04917  Prolactin signaling pathway
mpah04920  Adipocytokine signaling pathway
mpah04930  Type II diabetes mellitus
mpah04931  Insulin resistance
mpah04932  Non-alcoholic fatty liver disease
mpah04935  Growth hormone synthesis, secretion and action
mpah05160  Hepatitis C
mpah05164  Influenza A
mpah05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110332146 (Socs3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110332146 (Socs3)
   04668 TNF signaling pathway
    110332146 (Socs3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110332146 (Socs3)
   04920 Adipocytokine signaling pathway
    110332146 (Socs3)
   04917 Prolactin signaling pathway
    110332146 (Socs3)
   04935 Growth hormone synthesis, secretion and action
    110332146 (Socs3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110332146 (Socs3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110332146 (Socs3)
   04932 Non-alcoholic fatty liver disease
    110332146 (Socs3)
   04931 Insulin resistance
    110332146 (Socs3)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110332146 (Socs3)
   05164 Influenza A
    110332146 (Socs3)
   05168 Herpes simplex virus 1 infection
    110332146 (Socs3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110332146 (Socs3)
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     110332146 (Socs3)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 110332146
NCBI-ProteinID: XP_021068862
Ensembl: MGP_PahariEiJ_G0018603
LinkDB
Position
14
AA seq 225 aa
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPGTPSFSLPPTEPSSEVPEQPPAQALPGSTPKRAYYIYSGGEKIPLVLSR
PLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
NT seq 678 nt   +upstreamnt  +downstreamnt
atggtcacccacagcaagtttcccgccgccgggatgagccgccccctggacaccagcctg
cgcctcaagaccttcagctccaaaagcgagtaccagctggtggtgaacgccgtgcgcaag
ctgcaggagagcggattctactggagcgccgtgaccggcggcgaggcgaacctgctgctc
agcgccgagcccgcgggcacctttcttatacgcgacagctcggaccagcgccacttcttc
acgctgagcgtcaagacccagtcggggaccaagaacctacgcatccagtgcgaggggggc
agcttttcgctgcagagtgacccccgaagcacgcagccagttccccgcttcgactgtgta
ctcaagctggtgcaccactacatgccgcccccagggaccccctccttctctttgccaccc
acggaaccctcctccgaagttccggagcagcctcctgcccaggcactccccgggagtacc
cccaagagagcttactacatctattctgggggcgagaagattccgctggtactgagccga
cctctctcctccaacgtggccaccctccagcatctttgtcggaagactgtcaacggccac
ctggactcctatgagaaagtgacccagctgcctggacccattcgggagttcctggaccag
tatgatgctccactttaa

KEGG   Mus pahari (shrew mouse): 110333231
Entry
110333231         CDS       T05929                                 

Gene name
Socs6
Definition
(RefSeq) suppressor of cytokine signaling 6
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04630  JAK-STAT signaling pathway
mpah04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110333231 (Socs6)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    110333231 (Socs6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110333231 (Socs6)
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     110333231 (Socs6)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 110333231
NCBI-ProteinID: XP_021070431
Ensembl: MGP_PahariEiJ_G0019186
LinkDB
Position
15
AA seq 547 aa
MKKISLKTFRKSFNLSKSKDETEFMVVQPXSLAGDFVKDDSLFGSCYGKDMASCDIGSED
EKGKNRSKSESLMGTLKRRLSTKQKTKGKGXTAPTDEDTFSSASAPGGLKDVRAPRPIRS
TSLRSHHYSPTPWPLRPTSSEETCIKMEMRVKALVHAASPGPVNGVRKELRELQPKELXE
LQPRELLHPRELRDLQPEPRPESRCSPSSPGDLSLHLEEHVPVVIGLMSQDYLQYTVPLD
XGMCPLEGPRSCCLDTSSPMEVSAVPLPGASGAFSEDDSHVDQDLVVGPEILVDSSVNNL
LIGTTGVMLQNPRGGHDDAPPLSPLLPPMQNNPIQRNFSGLSGQDLHMAESVRCHLNFDP
NSAPGVARVYDSVQSSGPMVVTSLTEELKKLAKQGWYWGPITXWEAEGKLAXVPDGSFLV
RDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENG
AFCYSRSRLPGSATYPVRLTNPVSRFXQVRSLQYLCRFVIXQYTRIDLIQKLPLPNKMKD
YLQEKHY
NT seq 1644 nt   +upstreamnt  +downstreamnt
atgaagaaaatcagtctgaagaccttcaggaaatcttttaacctgagtaaaagcaaagat
gaaactgagttcatggtggttcagccccngtcccttgctggcgacttcgtgaaagatgac
tctttattcgggagctgctatggcaaagacatggctagttgtgacattggcagcgaggat
gagaaagggaagaacaggtccaaaagcgagagcctgatgggcactttgaagaggcggttg
tccaccaagcagaagactaagggcaagggnngcactgcacccacagatgaggacaccttc
tcctcagcttcagcncctggtgggctcaaggatgtgcgtgctccacggcccatccgctcc
acatcactgagaagccaccattatagccccacgccctggccgctgcgtcccaccagctcg
gaggagacatgcatcaagatggagatgcgagtgaaggcncttgtgcatgctgccagccca
ggaccagtcaacggtgtgcgcaaggagctgcgggagctgcagcccaaggagctgngggag
ctgcaacccagggagctactgcatcccagggagctgcgagacctgcagccagagccgcgc
cctgagtcccgctgcagccccagctcacccggggacctgagcctccacctggaggaacac
gtgcctgtagtaatcggactcatgtctcaggactaccttcagtacaccgtgcctttagat
gangggatgtgccctcttgaagggccgcgcagctgctgcctggatacgtcttctcccatg
gaggtgtcagcngtacccctgccaggggcgagtggtgccttctccgaagatgacagtcat
gtggaccaggacctggttgtaggcccagagatccttgtggattcatcagtgaacaacttg
ttgataggcaccacaggagtcatgttgcagaaccctagaggaggtcatgatgacgcccct
cccctctcaccgttgctacctccaatgcagaataacccaatccaaaggaacttcagtggc
ctctcaggccaagacttgcacatggccgaaagtgttcgntgtcatttgaatttcgatccc
aactctgcgcctggggttgctagagtttatgactcggtgcaaagtagtggccccatggtt
gttacaagtcttacggaggagctgaagaagcttgcaaaacaggggtggtactggggcccc
atcacangctgggaggcagaggggaagttggcaaangtgccagatggttcttttcttgtt
cgggatagttctgatgaccgttaccttttaagcctgagctttcgttctcatggtaaaaca
cttcacactagaattgagcactcaaatggtagattcagcttttatgaacaaccagatgtg
gaagggcatacatctatagttgacttaatcgagcattcaatcagggactctgaaaatgga
gcattttgttattcaaggtctcgattacctggatcagcaacttatccagtcagactaacc
aatccagtgtcacggttcatncaggtgcgctcnctgcagtatctgtgccgctttgttata
ngtcagtacaccagaatagacttaattcagaaactgcctttgccaaacaaaatgaaggat
tatttgcaggagaagcactactga

KEGG   Mus pahari (shrew mouse): 110335610
Entry
110335610         CDS       T05929                                 

Gene name
Socs5
Definition
(RefSeq) suppressor of cytokine signaling 5 isoform X1
  KO
K04698  suppressor of cytokine signaling 5
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04630  JAK-STAT signaling pathway
mpah04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110335610 (Socs5)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    110335610 (Socs5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110335610 (Socs5)
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     110335610 (Socs5)
SSDB
Motif
Pfam: SOCS SOCS_box SH2
Other DBs
NCBI-GeneID: 110335610
NCBI-ProteinID: XP_021073504
Ensembl: MGP_PahariEiJ_G0020933
LinkDB
Position
18
AA seq 536 aa
MDKVGKMWNNLKYRCQNLFSHEGGSRNENVEMNPNRCPSVKEKSISLGEAAPQQESSPLR
ENVALQLGLSPSKTFSRRNQNCAAEIPQVVEISIEKDSDSGATPGTRLARRDSYSRHAPW
GGKKKHSCSTKTQSSLDTEKKFGRSRSGLQRRERRYGVSSMQDMDSVSSRTVGSRSLRQR
LQDTVGLCFPMRTYSKQSKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWHLIKQHTAPV
SPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLG
PKLAPGMTEISGDGSVIPQTNCDSEEDSTTLCLQSRRQKQRQVSGDSHAHISRQGAWKVH
TQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFR
RYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNRTF
PFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPVKAK
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggataaagtggggaaaatgtggaacaacttaaaatacagatgccagaatctcttcagc
catgaaggaggaagccgtaatgaaaatgtggagatgaaccccaacagatgtccgtctgtc
aaagagaaaagcatcagtctgggagaggcagctccccagcaagagagcagtcccttaaga
gaaaatgttgccttacagctgggactgagcccttcaaagaccttttccaggaggaaccaa
aactgtgccgcagagatccctcaggtcgttgaaataagcatcgagaaggacagtgactcg
ggtgccaccccaggaacgaggctcgcacgaagagactcctattcccgacatgccccgtgg
ggaggaaagaagaaacattcctgttccacaaagacccagagttcattggatactgagaaa
aagtttggtagatctcgaagcggccttcagaggcgagagcggcgctatggagtcagctcc
atgcaggacatggacagtgtttctagccgcaccgtcgggagccgctctctgaggcagagg
ctccaggacacggtgggtttgtgttttcccatgagaacttacagcaagcagtcaaaacca
ctcttttccaataaaagaaaaatacatctttctgaattaatgctggagaaatgtcctttc
cctgctggctcggatttggcacaaaagtggcatttgattaaacagcataccgcccctgtg
agcccacactcaacattttttgatacatttgatccatcactggtgtctacagaagatgaa
gaagataggcttcgcgagagaaggcggcttagtatcgaagaaggggtggatccccctccc
aatgcacaaatacacacctttgaagctactgcacaggttaatccattgtataagctggga
ccaaagttagctcccgggatgacagaaataagtggagatggttctgtaattccacaaacg
aattgtgactcagaagaggattccaccaccctatgtctgcagtcacggaggcagaagcag
cgccaggtgtccggggacagccacgcgcacattagcagacagggagcttggaaagttcat
acgcagatcgattacatacactgccttgtgccagatttgcttcagatcacagggaatccc
tgttactggggcgtgatggaccgatacgaagcagaagcccttctagaagggaaaccggaa
ggcacgttcttgctcagggactctgcgcaggaggactacctcttctctgtgagcttccgc
cgctacaacaggtctctgcacgcccggatagagcagtggaaccacaacttcagcttcgat
gcccatgacccctgcgtgtttcactcctccactgtcacggggcttctcgaacactataaa
gaccccagctcttgcatgttttttgaaccgttgcttacgatatccctgaataggactttt
cctttcagcctgcagtatatctgccgcgcagtgatctgcaggtgcactacgtatgatggg
attgatgggctccctctaccgtcaatgttacaggattttttaaaagagtatcattataaa
caaaaagttagggttcgctggttagaacgagagccagtcaaggcaaagtaa

DBGET integrated database retrieval system