KEGG   Mus pahari (shrew mouse): 110325811
Entry
110325811         CDS       T05929                                 

Gene name
Irf9
Definition
(RefSeq) interferon regulatory factor 9 isoform X1
  KO
K04693  interferon regulatory factor 9
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04217  Necroptosis
mpah04380  Osteoclast differentiation
mpah04621  NOD-like receptor signaling pathway
mpah04625  C-type lectin receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah05160  Hepatitis C
mpah05162  Measles
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05171  Coronavirus disease - COVID-19
mpah05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110325811 (Irf9)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110325811 (Irf9)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110325811 (Irf9)
   04625 C-type lectin receptor signaling pathway
    110325811 (Irf9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110325811 (Irf9)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110325811 (Irf9)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110325811 (Irf9)
   05171 Coronavirus disease - COVID-19
    110325811 (Irf9)
   05164 Influenza A
    110325811 (Irf9)
   05162 Measles
    110325811 (Irf9)
   05168 Herpes simplex virus 1 infection
    110325811 (Irf9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110325811 (Irf9)
   05169 Epstein-Barr virus infection
    110325811 (Irf9)
   05165 Human papillomavirus infection
    110325811 (Irf9)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    110325811 (Irf9)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 110325811
NCBI-ProteinID: XP_021059586
Ensembl: MGP_PahariEiJ_G0030320
LinkDB
Position
8
AA seq 461 aa
MLLPGGELKLRVGTVERGGEIRKSLEPAEPGTSSAAQALPTSSAPPLPPAAAPPTPLAKR
GMVGRRMASGKVRCTRKLRSWIVQQVESGQFPGVCWDDAAKTMFRIPWKHAGKQDFREDQ
DAAIFKAWALFKEKHKDGDIGHPAVWKTRLRCALNKSSEFEEVPERGRMDVAEPYKVYRI
LPAGTLPTQPRSQKSPCKRSISCVSPEREENKENGRTSGVVNHSDSGSNLGCGGGGSSSS
SSSSELEEGAGVTEATIKEDPVSLEHQLPLNSDYSLLLTFIYGGRVVGKTQVHSLDCRLV
AERSDSESSMEQVEFPKPDPLEPTQRLLSQLERGVLVASNSRGLFVQRLCPIPISWNAPE
APPGPGPHLLPSNKCVELFKTTYFCRDLVQYFQGQGPPPKFQATLHFWEGSPGSSHSQEN
LITVQMEQAFARHLLEKIPEEEKAALFLLQHTEQSPAALGL
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgctcctcccaggaggagaactgaaacttagggtggggactgtagaaaggggaggagag
atcagaaaaagcctagaaccagctgagcctgggacctcctcggcagctcaggccctgccc
acttcttcagctccgcccttgcccccagctgctgccccacctacccctctagcaaagagg
ggcatggtaggaagaaggatggcctcaggcaaagtacgctgcacccgaaagctgcggagc
tggatcgtgcagcaggtggagagtggccagttcccaggggtatgctgggacgatgccgcc
aagaccatgttccggattccctggaagcacgcgggcaagcaagacttccgagaggaccag
gatgcggccatattcaaggcttgggcactgtttaaggaaaagcacaaagatggggacata
ggacaccctgctgtctggaagactcgcctacgttgtgccctcaacaagagttccgaattt
gaggaggttcctgagagaggtcgtatggatgttgctgaaccctacaaagtatatcgaata
ctgccagcagggaccctccctacccaaccacgaagccagaaatcaccatgcaagcgaagt
atcagttgtgtgtcacctgagagggaagagaataaggaaaatgggagaaccagtggagtt
gtaaaccactcagacagtggcagcaacttgggctgtggtggcggtggcagcagcagcagc
agcagcagctctgaacttgaggagggagctggtgtaactgaggccaccattaaagaggac
ccagtgtccctggagcatcaacttcccctgaactcagactactcactgctgctcaccttc
atctatggtggccgagtggtgggtaagacccaggtacacagcctagactgtcggctcgtg
gctgagcgctcagactcagagagcagcatggagcaggtggagtttcccaaacctgaccca
ctggagccaacccagcgcctgctgagtcaacttgagagaggggtcctggtggccagcaat
tccagaggcctctttgttcagcgcctttgccccatccccatctcctggaacgcacctgag
gccccacccgggcccggtcctcatctgctgcccagcaataagtgtgtggagctcttcaag
accacctacttctgtagagatttggttcagtacttccagggtcaggggcccccacccaag
ttccaagcaaccctacatttctgggaggggagtcctggctctagccatagccaagagaat
ctcatcacagtgcagatggagcaggcctttgcccgacatttactggagaagattccagag
gaagagaaagccgccttgttcctgttacagcacacagagcagtcacctgccgctctcgga
ctctga

DBGET integrated database retrieval system