KEGG   Mus pahari (shrew mouse): 110325918
Entry
110325918         CDS       T05929                                 

Gene name
Lats2
Definition
(RefSeq) serine/threonine-protein kinase LATS2 isoform X1
  KO
K08791  serine/threonine-protein kinase LATS1/2 [EC:2.7.11.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
mpah04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110325918 (Lats2)
   04392 Hippo signaling pathway - multiple species
    110325918 (Lats2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110325918 (Lats2)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110325918 (Lats2)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: AGC group
  NDR family
   110325918 (Lats2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C UBA APH Kdo Pox_ser-thr_kin Kinase-like
Other DBs
NCBI-GeneID: 110325918
NCBI-ProteinID: XP_021059737
Ensembl: MGP_PahariEiJ_G0030371
LinkDB
Position
8
AA seq 1040 aa
MRPKTFPATTYSGNSRQRLQEIREGLKQPSKSSTQGLLVGPNSDTSLDAKVLGGKDASRQ
QQMRATPKFGPYQKALREIRYSLLPFANESGTSAAAEVNRQMLQELVNAGCDQEMAGRAL
KQTGSRSIEAALEYISKMGYLDPRNEQIVRVIKQTSPGKGLAPAPVTRRPSFEGTGEALT
SYHQLGSANYEGPAALEEMPRQYLDFLFPGAGTQGAPAHQHPPKGYSTTVEPGAHFPGTH
YGRGHLRSEQPGYGVQRSPSFQSKTPPDAYSGLAKAQGGPPASLTFPAHAGLYAASHHKP
AATPPGAHPLHVLGTRGPTFTGESSAQAVLAPSRNSLNADLYELSSTVPWSAAPLARRDS
LQKQGLEASRPHVAFRAGPSRTNSFNNPQPEPSLPAPNTVTAVTAAHILHPVKSVRVLRP
EPQTAVGPSHPAWVTAPTAPATESLETKEGSAGPHPLDVDYGGSERRCPPPPYPKHLLLP
SKSEQYSVDLDSLCTSVEQSLRGGTEQDKNDKSHKGAKGDKAGRDKKQIQTSPVPVRKNS
RDEEKRESRIKSYSPYAFKFFMEQHVENVIKTYQQKVSXRLQLEQEMAKAGLCEAEQEQM
RKLLYQKESNYNRLKRAKMDKSMFVKIKTLGIGAFGEVCLACKVDTHALYAMKTLRKKDV
LNRNQVAHVKAERDILAEADNEWVVKLYYSFQDKDSLYFVMDYIPGGDMMSLLIRMEVFP
EHLARFYIAELTLAIESVHKMGFIHRDIKPDNILIDLDGHIKLTDFGLCTGFRWTHNSKY
YQKGNHIRQDSMEPGDLWDDVSNCRCGDRLKTLEQRAQKQHQRCLAHSLVGTPNYIAPEV
LLRKGYTQLCDWWSVGVILFEMLVGQPPFLAPTPTETQLKVINWESTLHIPTQVRLSAEA
RDLITKLCCAADCRLGRDGADDLKAHPFFNAIDFSRDIRKQPAPYVPTISHPMDTSNFDP
VDEESPWHEASGESAKAWDXLASPSSKHPEHAFYEFTFRRFFDDNGYPFRCPKPSEPAES
ADPGDVELEGAAEGCQPVYV
NT seq 3123 nt   +upstreamnt  +downstreamnt
atgaggccaaagacttttcctgccacaacttactctggaaatagccggcagcgattgcaa
gagattcgagaggggctgaagcagccgtccaagtcttccacccaggggctgctggtggga
ccaaacagtgacacttccctggatgccaaagtcctggggggcaaagatgcctccaggcag
cagcaaatgagagccaccccgaagtttggaccttatcaaaaagcgctcagggaaatccga
tattccctcctgccttttgccaacgagtcaggcacttcagcagctgcagaggtgaaccgg
cagatgcttcaggagttggtgaatgcgggatgtgaccaggagatggctggcagagcgctc
aagcagacgggcagtaggagtattgaggccgccttggagtacatcagtaagatgggctac
ctggacccaaggaatgagcagattgtgcgagtcatcaagcagacctccccaggaaagggc
ctggcgcccgccccggtgactcggcggcccagtttcgagggcacaggggaagcactcaca
tcttaccaccagctgggtagtgcaaactacgagggccccgccgcactggaggagatgccg
cggcaatatttagacttcctcttccccggagcgggcacccaaggtgccccggctcaccaa
caccctcccaaaggctacagcaccacagtggagccgggtgcgcacttcccgggcacacac
tatggtcgtggtcatctacgatcagagcagcctgggtatggggtgcagcgcagcccctcc
ttccagagcaagacgccaccagatgcctattccggcctggccaaggcccagggtggccct
cccgccagcctcacctttcctgcccatgctgggctgtacgccgcctcgcaccacaagccg
gcggctaccccacctggggcccacccgttacacgttttgggcacccggggtcccacgttt
actggtgaaagctctgcacaagctgtgctggcaccatccaggaacagcctcaatgctgac
ttgtacgagctgagctccaccgtgccctggtctgcagccccactggcacgccgtgactcg
ttgcaaaagcagggtctagaggcctcgaggccgcatgtggctttccgggctggccccagc
aggaccaactccttcaacaacccacaaccggaaccctcactgcccgcccccaacacggtc
accgctgtgactgctgcacacatccttcaccccgtgaagagcgtgcgtgtgctgcggccc
gagccccagacagccgtggggccctcgcaccccgcctgggtgactgcgcccacagcacct
gccaccgagagcctggagacaaaggagggcagcgcaggcccacacccactggatgtggac
tatggcggctccgagcgcaggtgcccaccgcctccatacccaaagcacttgctgctgccc
agtaagtctgagcagtacagtgtggacctggacagcctgtgcaccagtgtggagcagagt
ctgcgagggggcactgagcaagacaagaatgacaagagccacaaaggtgcgaagggagac
aaagctggcagagacaaaaagcagatccagacctccccggtgcctgtccgcaagaatagc
agggatgaagagaagagagagtctcgcatcaagagttactccccttatgccttcaaattc
ttcatggaacaacacgtggagaatgtcatcaaaacctaccagcagaaggtcagccngagg
ctacagctggagcaggaaatggccaaagccgggctctgtgaggctgagcaggagcagatg
aggaagctcctctaccagaaggagtctaactacaaccgcctgaagagggctaagatggac
aagtccatgtttgtgaaaatcaagacgctgggcatcggtgcctttggggaagtgtgcctc
gcctgtaaggtggacactcacgctctgtacgccatgaagactctcaggaagaaagatgtc
ctgaaccggaatcaagtggcccatgtcaaggctgagagggacatcctggctgaagcagac
aatgagtgggtggtcaaactctactactccttccaggacaaggacagcctgtactttgtg
atggactacatccctggcggggatatgatgagcctgctgattcggatggaggtcttccct
gaacacctggcccgcttctacattgcggagctgactctggccattgagagtgtccacaag
atgggctttatccaccgggatatcaagcctgacaacatcctcatcgacctggatggtcat
attaagctgacagactttggcctctgcactggattcaggtggactcacaattccaagtac
taccagaaagggaaccacatcagacaggacagcatggagcctggtgacctctgggacgat
gtttccaattgtcgttgtggggataggttaaagaccctggagcagagagcgcagaagcag
caccagaggtgcctggcacattctctagttgggacaccaaattacatcgctccggaggtg
ctcctccgcaaagggtatacacagctctgtgactggtggagtgtcggggtgattctcttt
gaaatgctggttgggcagccacctttcttggcacctacccccacagaaacccagctgaag
gtgatcaactgggagagtacgctgcacatccccacgcaggtgaggctcagcgccgaggcc
cgggacctcatcacgaagctgtgctgcgcggctgactgccgcctgggcagggatggggca
gatgacctcaaggcacacccattcttcaacgccatcgacttttcccgtgacatccgaaag
cagcccgcgccctatgtccccaccatcagccaccccatggacacctccaattttgacccg
gtggatgaagaaagcccctggcacgaggccagcggagagagtgccaaggcctgggacang
ctggcctcccccagcagcaagcatccagagcacgccttctatgagttcaccttccgcagg
ttcttcgatgacaatggctatcccttccggtgcccgaagccctcagaaccagctgaaagt
gcagacccaggggatgtggagttagaaggtgcggcggagggctgccagccggtgtacgtg
taa

KEGG   Mus pahari (shrew mouse): 110338161
Entry
110338161         CDS       T05929                                 

Gene name
Lats1
Definition
(RefSeq) serine/threonine-protein kinase LATS1
  KO
K08791  serine/threonine-protein kinase LATS1/2 [EC:2.7.11.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
mpah04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110338161 (Lats1)
   04392 Hippo signaling pathway - multiple species
    110338161 (Lats1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110338161 (Lats1)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110338161 (Lats1)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: AGC group
  NDR family
   110338161 (Lats1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr UBA Cas_Cas6 APH Kinase-like Pkinase_C EcoEI_R_C Pox_ser-thr_kin UBA_3
Other DBs
NCBI-GeneID: 110338161
NCBI-ProteinID: XP_021077074
Ensembl: MGP_PahariEiJ_G0023719
LinkDB
Position
21
AA seq 1129 aa
MKRGEKPEGYRQMRPKTFPASNYPGSSRQMLQEIRESLRNLSKPSDASKAEHNLNKMSTE
DPRQVRNPPKFGTHHKALQEIRNSLLPFANETSSSRSPSEVNPQMFQDLQAAGFDEDMVI
QALQKTNNRSIEAAVEFISKMSYQDPRREQMSAAAARPINATMKPGNVQHSINRKQSWKG
SKESLVPQRHGPSLGENVVYRSESPNSQADVGRPLSGSGITAFAQAHPSNSQRVNPPPPP
QVRSVTPPPPPRGQTPPPRGTTPPPPSWEPNSQTKRYSGNMEYVISRISPVPPGAWQEGY
PPPPLNTSPMNPPNQGQRAINSVPVGRQPIIMQSASKFNFTPGRPGVQNGGGQTDFIVHQ
NVPTGSVNRQPPPPYPLTPANGQSPSALQTGGSAAPPSFANGNVPQSMMVPNRNSHNMEL
YNINVPGLQTTWPQSSSAPVQSSPSGGHEIPTWQPNIPVRSNSFNNPLGSRASHSANSQP
SATTVTAITPAPIQQPVKSMRVLKPELQTALAPTHPSWMPQPVQTVQPNPFSEGTASNVP
VIPPVAEAPSYQGPPPPYPKHLLHQNPPVPPYESVSKPCKDEQPSLPKEDDSEKSLDSVD
SGDKEKKQITTSPITVRKNKKDEERRESRIQSYSPQAFKFFMEQHVENVLKSHQQRLHRK
KQLENEMMRVGLSQDAQDQMRKMLCQKESNYIRLKRAKMDKSMFVKIKTLGIGAFGEVCL
ARKVDTKALYATKTLRKKDVLLRNQVAHVKAERDILAEADNEWVVRLYYSFQDKDNLYFV
MDYIPGGDMMSLLIRMGIFPENLARFYIAELTCAVESVHKMGFIHRDIKPDNILIDRDGH
IKLTDFGLCTGFRWTHDSKYYQSGDHPRQDSMDFSNEWGDPSNCRCGDRLKPLERRAARQ
HQRCLAHSLVGTPNYIAPEVLLRTGYTQLCDWWSVGVILFEMLVGQPPFLAQTPLETQMK
VINWQTSLHIPPQAKLSPEASDLIIKLCRGPEDRLGKNGADEIKAHPFFKTIDFSSDLRQ
QSASYIPKITHPTDTSNFDPVDPDKLWSDGSEEESISDTLNGWYKNGKHPEHAFYEFTFR
RFFDDNGYPYNYPKPIEYEYIHSQGSEQQSDEDDQHSSSDGNNRDLVYV
NT seq 3390 nt   +upstreamnt  +downstreamnt
atgaagaggggtgaaaagccagaagggtacagacagatgaggcctaagacctttcctgcc
agcaactaccctggcagcagccggcagatgctgcaggagatccgagaatccctgaggaat
ttgtcaaaaccatctgatgcttcgaaggccgagcataacctcaacaagatgtcgactgaa
gatcccaggcaggtgagaaatccacccaaatttggcacacatcataaagccttgcaagaa
attcgaaactctctactgccgtttgcaaacgagacaagctcttcccggagcccttcagaa
gttaatccacagatgtttcaggatttgcaggctgctggctttgatgaggacatggttatt
caagctcttcagaaaaccaataacagaagcatagaagctgctgttgaattcattagtaaa
atgagttaccaggaccctcgtcgagagcagatgtctgcagcagctgccaggcccattaat
gccaccatgaaaccaggaaacgtgcaacattcaattaaccgaaaacaaagctggaaaggt
tctaaagagtctttagttcctcagagacatggtccatctctaggagaaaatgtggtttat
cgttctgaaagccccaactcacaggcggatgtaggaagacctctgtctggatccggcatt
acagcatttgctcaagctcacccaagcaatagccagagagtgaaccccccaccaccacct
caagttaggagtgttactcctccaccacctccgagaggccagaccccgcccccacgaggc
accactccacctcccccctcatgggaaccaaactctcaaacaaagcgctactctgggaac
atggaatacgtcatctcccgaatctctcctgttccacctggggcgtggcaggagggctac
cctccaccacctcttaacacttctcccatgaatccccctaaccagggacagagggccatt
aattctgttccagttggtagacaaccaatcatcatgcaaagtgctagcaaatttaacttt
acaccagggcgacctggcgttcagaatggtggtggtcagactgattttatcgtgcaccaa
aatgtccccactggttctgtgaatcggcaaccaccacctccatatcctctgaccccagct
aatggacaaagcccttctgctttacaaacggggggttctgctgctccgccgtcattcgcc
aatggaaacgttcctcagtcgatgatggtgccaaacaggaacagtcataacatggagctt
tataatattaatgtccctggactacaaacaacttggccccagtcatcttctgctcctgtg
cagtcatccccaagcggtgggcatgaaattcctacatggcaacctaacataccagtgagg
tcaaattcttttaataacccattaggaagtagagcaagtcactctgctaattctcagcct
tctgccactacagtcactgcgatcacaccagctcctattcaacagcccgtgaaaagcatg
cgcgtcctgaaaccagagcttcagactgcgttagccccaacccatccttcttggatgcca
cagccagttcagaccgttcagcctaaccctttttctgagggtacagcttcaaacgtgccc
gtcatcccacctgttgctgaagctccaagctatcaaggtccaccaccaccttatccaaaa
catctgctacaccaaaacccacctgttcctccatatgaatcggtcagtaagccctgcaaa
gatgaacagcctagcttacccaaggaagatgatagtgaaaagagtttggacagcgttgac
tctggggataaagaaaaaaaacagattacaacttcgcccatcactgttcggaaaaacaag
aaagatgaagaacgaagagagtctcggattcagagttactccccacaggcctttaagttc
ttcatggagcaacacgtggagaatgtcctgaagtctcaccagcagcggctgcatcggaag
aagcagctagaaaacgaaatgatgcgggttggattatctcaagatgcccaggatcaaatg
agaaaaatgctttgccagaaagagtctaactatattcgtcttaaaagggctaaaatggac
aagtctatgtttgtaaagataaagacattaggaataggagcgtttggtgaagtctgtcta
gcaagaaaagtcgatactaaagctttgtatgcaacaaaaactctgcgaaagaaagatgtt
ctgctccgaaatcaggtggcccatgtgaaagctgagagagatatcctggcagaagctgac
aatgagtgggtggtccgcctgtactactctttccaggacaaggacaacttgtactttgtg
atggactacattcctggaggggatatgatgagcctattaattagaatgggcatctttcct
gaaaatctggcacgattctacatagcagaacttacctgtgccgttgaaagtgttcataaa
atgggttttatccatagagatattaagcctgataacattttgattgaccgcgatggtcat
attaaattgactgactttggcttgtgcactggcttcagatggacacatgactccaagtac
taccagagtggggatcacccacggcaagatagcatggatttcagtaacgaatggggagat
ccttccaattgtcggtgtggggacagactgaagccactggagcggagagctgctcgccag
caccagcgatgtctagcacattctctggttgggactcccaattatattgcacctgaagtg
ctactgcgaacaggctatacacagctgtgtgactggtggagcgtcggggttattcttttt
gaaatgttggtgggacaacctcctttcttggcacaaaccccattagaaacacaaatgaag
gttatcaactggcaaacttctcttcacatccctcctcaagctaagctgagtcctgaagcc
tctgacctcattatcaaactttgccgaggaccagaagaccgcctcggcaagaacggtgct
gatgaaataaaggctcatccgttttttaagaccatagatttctctagtgatctgagacag
cagtctgcttcatacatccctaaaatcacacatccaacagatacgtccaatttcgaccct
gttgatcctgataagttgtggagcgatggtagtgaggaagaaagtatcagtgacactctg
aacggatggtataaaaatgggaagcaccctgagcatgctttctatgagttcacctttcgg
aggttttttgatgacaatggctacccatataattatccaaagcctatcgagtatgaatac
attcattcacagggctcagagcaacagtctgatgaagatgatcaacactcaagctccgat
ggaaacaaccgtgatctagtgtatgtttaa

DBGET integrated database retrieval system