KEGG   Mus pahari (shrew mouse): 110325926
Entry
110325926         CDS       T05929                                 

Gene name
Cebpe
Definition
(RefSeq) CCAAT/enhancer-binding protein epsilon
  KO
K10051  CCAAT/enhancer binding protein (C/EBP), epsilon
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah05202  Transcriptional misregulation in cancer
mpah05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110325926 (Cebpe)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    110325926 (Cebpe)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   C/EBP-like factors
    110325926 (Cebpe)
SSDB
Motif
Pfam: bZIP_2 bZIP_1 Taxilin UPF0449 GAS DUF2514 SBE2 Fib_alpha DivIC TSC22 Phlebovirus_NSM
Other DBs
NCBI-GeneID: 110325926
NCBI-ProteinID: XP_021059748
Ensembl: MGP_PahariEiJ_G0030288
LinkDB
Position
8
AA seq 281 aa
MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAM
KPTPEARSLKGPGAPSFPHYLPADPRPFAYPSHTFGPDRKALGPGIYSNPGSYDPRAVAV
KEEPRGPEGNRGTSRGSYNPLQYQVAHCGQTAVHLPPTLAAPGQPLRVLKAPVAAAAPPC
SPLLKAPSPAGPSHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRIMETQQKVLEYM
AENERLRSRVDQLTQELDTLRNLFRQIPEAASLIKGVGGCS
NT seq 846 nt   +upstreamnt  +downstreamnt
atgtcccacgggacctactatgagtgtgagcctcggggtggccagcagccacttgagttc
tcagggggtcgagctgggcccggggagctgggggacatgtgtgagcatgaggcctccatc
gacctctccgcctacatcgagtctggggaagaacagctactttctgacctctttgccatg
aagccaacgcctgaagcccgaagccttaagggcccaggagccccgtcgtttcctcactac
ctgccggctgaccctcggccattcgcctatccctcacacacatttggcccagataggaag
gctttggggcctggcatctacagcaacccagggagctacgatcccagggctgtggcggtg
aaggaggagcctcgtgggccagagggcaaccgaggcaccagccgaggcagctacaatcct
ctgcagtaccaagtggcacactgcgggcagacagccgtgcacctccccccgaccctggca
gcacctggccagcccctgcgtgtcctcaaggcccccgtggctgctgctgcccctccctgc
agccccctcctcaaggcaccctcccctgctggcccttcacataagggcaagaaggcagtg
aacaaagatagcctggagtaccggctgcgacgcgaacgcaacaacatcgcggtgcgcaag
agccgggacaaggccaagaggcgcattatggagacccagcagaaggtcctggagtacatg
gctgaaaacgagcgtctgcgcagccgtgtggaccagctcacccaggagttagacactctg
cgcaacctcttccgacagatccctgaggctgccagcctcatcaaaggtgtcgggggctgc
agctga

DBGET integrated database retrieval system