KEGG   Mus pahari (shrew mouse): 110326196
Entry
110326196         CDS       T05929                                 

Gene name
Cdk4
Definition
(RefSeq) cyclin-dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01522  Endocrine resistance
mpah04110  Cell cycle
mpah04115  p53 signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04218  Cellular senescence
mpah04530  Tight junction
mpah04660  T cell receptor signaling pathway
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04934  Cushing syndrome
mpah05160  Hepatitis C
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05169  Epstein-Barr virus infection
mpah05200  Pathways in cancer
mpah05203  Viral carcinogenesis
mpah05212  Pancreatic cancer
mpah05214  Glioma
mpah05218  Melanoma
mpah05219  Bladder cancer
mpah05220  Chronic myeloid leukemia
mpah05222  Small cell lung cancer
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110326196 (Cdk4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110326196 (Cdk4)
   04115 p53 signaling pathway
    110326196 (Cdk4)
   04218 Cellular senescence
    110326196 (Cdk4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110326196 (Cdk4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    110326196 (Cdk4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110326196 (Cdk4)
   05203 Viral carcinogenesis
    110326196 (Cdk4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110326196 (Cdk4)
   05225 Hepatocellular carcinoma
    110326196 (Cdk4)
   05214 Glioma
    110326196 (Cdk4)
   05220 Chronic myeloid leukemia
    110326196 (Cdk4)
   05218 Melanoma
    110326196 (Cdk4)
   05219 Bladder cancer
    110326196 (Cdk4)
   05224 Breast cancer
    110326196 (Cdk4)
   05222 Small cell lung cancer
    110326196 (Cdk4)
   05223 Non-small cell lung cancer
    110326196 (Cdk4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110326196 (Cdk4)
   04934 Cushing syndrome
    110326196 (Cdk4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110326196 (Cdk4)
   05160 Hepatitis C
    110326196 (Cdk4)
   05164 Influenza A
    110326196 (Cdk4)
   05162 Measles
    110326196 (Cdk4)
   05163 Human cytomegalovirus infection
    110326196 (Cdk4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110326196 (Cdk4)
   05169 Epstein-Barr virus infection
    110326196 (Cdk4)
   05165 Human papillomavirus infection
    110326196 (Cdk4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110326196 (Cdk4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110326196 (Cdk4)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     110326196 (Cdk4)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: CMGC group
  CDK family
   110326196 (Cdk4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like
Other DBs
NCBI-GeneID: 110326196
NCBI-ProteinID: XP_021060052
Ensembl: MGP_PahariEiJ_G0031207
LinkDB
Position
9
AA seq 304 aa
MAATRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGAAGGGLPVSTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDL
MRQFLSGLDFLHANCIVHRDLKPENILVTSNGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
EVSLPRGAFVPRGPRPVRSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKEES
DDAE
NT seq 915 nt   +upstreamnt  +downstreamnt
atggctgccactcgatatgaacccgtggctgaaattggtgtcggtgcctatgggacggtg
tacaaagcccgagatccccacagtggccactttgtagccctcaagagtgtgagagttcct
aatggaggagcagctggagggggccttccggtcagcacagttcgtgaggtggccttgtta
aggagactggaggcctttgaacatcccaatgttgtacggctgatggatgtctgtgctact
tcccgaactgatcgggacatcaaggtcaccctagtgtttgagcatatagaccaggaccta
aggacatatctggacaaagcacctccaccaggcctgccggttgagaccattaaggatctg
atgcggcagtttctaagcggcctcgattttcttcatgcaaactgcattgttcaccgggac
ctgaaaccagagaacattctagtgacaagtaatgggaccgtcaagctggctgactttggc
ctagctagaatctacagctaccagatggccctcacgcctgtggttgttacgctctggtac
cgggctcctgaagttcttctgcagtctacgtatgcaacccccgtggacatgtggagcgtt
ggctgtattttcgcagagatgtttcgtcggaagcctctcttctgtggaaactctgaagct
gaccagttggggaaaatctttgatctcattggattgcctccagaagacgactggcctcga
gaggtatccctacctcgaggagcctttgtccccagagggcctcggccagtgcggtcagtg
gtgccagagatggaggagtctggagcgcagctgctgctggaaatgctgacctttaaccca
cataagcgaatctctgccttccgagccctgcagcactcctacctgcacaaggaggaaagc
gacgacgccgagtga

DBGET integrated database retrieval system