KEGG   Mus pahari (shrew mouse): 110326225
Entry
110326225         CDS       T05929                                 

Gene name
Kitlg
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04640  Hematopoietic cell lineage
mpah04916  Melanogenesis
mpah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110326225 (Kitlg)
   04014 Ras signaling pathway
    110326225 (Kitlg)
   04015 Rap1 signaling pathway
    110326225 (Kitlg)
   04072 Phospholipase D signaling pathway
    110326225 (Kitlg)
   04151 PI3K-Akt signaling pathway
    110326225 (Kitlg)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110326225 (Kitlg)
  09152 Endocrine system
   04916 Melanogenesis
    110326225 (Kitlg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110326225 (Kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110326225 (Kitlg)
Cytokines and growth factors [BR:mpah04052]
 Growth factors
  Growth factors (RTK binding)
   110326225 (Kitlg)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 110326225
NCBI-ProteinID: XP_021060108
Ensembl: MGP_PahariEiJ_G0031319
LinkDB
Position
9
AA seq 313 aa
MKKTQVSRARPGGARKLSKKIAPGAPGSPARPGTGNPAMWGCALPTWIITCIYLQLLLFN
PLVKTKEICGSPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTQLSVS
LTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVECMEENAPKTGKESLKRQETRLFTPEEF
FSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVAASSLRNDSSSS
NRKAAKSPEDSGLQWTAMALPALISLVIGFAFGALYWKKKQSSLTRAVENIQINEEDNEI
SMLQQKEREFQEV
NT seq 942 nt   +upstreamnt  +downstreamnt
atgaagaagacacaagtgagtagggcacgcccgggaggagctcggaagctttccaagaaa
atcgctccgggagccccggggagcccggcgcgccctgggaccggcaacccggccatgtgg
ggctgcgctctcccgacttggattatcacttgcatttatcttcaactgctcctatttaat
cctctcgtcaaaactaaggagatctgcgggagtcctgtgactgataatgtaaaagacatt
acaaaactggtggcaaatcttccaaatgactatatgataaccctcaactatgtcgccggg
atggatgttttgcctagtcattgttggctacgagatatggtgacacagttgtcagtcagc
ttgaccactcttctggataagttctcaaatatttctgaaggcttgagtaattactccatc
atagacaaacttgggaaaatagtggatgaccttgtggaatgtatggaagaaaacgctcct
aagactggaaaagaatctctgaagaggcaagaaactagactctttactcctgaagaattc
ttcagtattttcaatagatccattgatgcctttaaggactttatggtggcatctgacact
agtgactgtgtgctctcttcaacattaggtcccgagaaagattccagagtcagtgtcaca
aaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagcagt
aataggaaagccgccaagtcccctgaagactcgggcctacaatggacagccatggcattg
ccggctctcatttcgcttgtaattggctttgcttttggagccttatactggaagaagaaa
cagtcaagtcttacaagggcagttgaaaatatacagattaatgaagaggataatgagata
agtatgttgcaacagaaagaaagagaatttcaagaggtgtaa

DBGET integrated database retrieval system