KEGG   Mus pahari (shrew mouse): 110326250
Entry
110326250         CDS       T05929                                 

Gene name
Bad
Definition
(RefSeq) bcl2-associated agonist of cell death isoform X1
  KO
K02158  Bcl-2-antagonist of cell death
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah01524  Platinum drug resistance
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04140  Autophagy - animal
mpah04151  PI3K-Akt signaling pathway
mpah04210  Apoptosis
mpah04370  VEGF signaling pathway
mpah04510  Focal adhesion
mpah04722  Neurotrophin signaling pathway
mpah04910  Insulin signaling pathway
mpah04919  Thyroid hormone signaling pathway
mpah05010  Alzheimer disease
mpah05014  Amyotrophic lateral sclerosis
mpah05020  Prion disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05145  Toxoplasmosis
mpah05152  Tuberculosis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05165  Human papillomavirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05203  Viral carcinogenesis
mpah05210  Colorectal cancer
mpah05211  Renal cell carcinoma
mpah05212  Pancreatic cancer
mpah05213  Endometrial cancer
mpah05215  Prostate cancer
mpah05218  Melanoma
mpah05220  Chronic myeloid leukemia
mpah05221  Acute myeloid leukemia
mpah05223  Non-small cell lung cancer
mpah05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110326250 (Bad)
   04014 Ras signaling pathway
    110326250 (Bad)
   04370 VEGF signaling pathway
    110326250 (Bad)
   04024 cAMP signaling pathway
    110326250 (Bad)
   04022 cGMP-PKG signaling pathway
    110326250 (Bad)
   04151 PI3K-Akt signaling pathway
    110326250 (Bad)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110326250 (Bad)
  09143 Cell growth and death
   04210 Apoptosis
    110326250 (Bad)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110326250 (Bad)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    110326250 (Bad)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110326250 (Bad)
   04919 Thyroid hormone signaling pathway
    110326250 (Bad)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110326250 (Bad)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110326250 (Bad)
   05203 Viral carcinogenesis
    110326250 (Bad)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110326250 (Bad)
   05212 Pancreatic cancer
    110326250 (Bad)
   05225 Hepatocellular carcinoma
    110326250 (Bad)
   05221 Acute myeloid leukemia
    110326250 (Bad)
   05220 Chronic myeloid leukemia
    110326250 (Bad)
   05218 Melanoma
    110326250 (Bad)
   05211 Renal cell carcinoma
    110326250 (Bad)
   05215 Prostate cancer
    110326250 (Bad)
   05213 Endometrial cancer
    110326250 (Bad)
   05223 Non-small cell lung cancer
    110326250 (Bad)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110326250 (Bad)
   05014 Amyotrophic lateral sclerosis
    110326250 (Bad)
   05020 Prion disease
    110326250 (Bad)
   05022 Pathways of neurodegeneration - multiple diseases
    110326250 (Bad)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110326250 (Bad)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110326250 (Bad)
   05161 Hepatitis B
    110326250 (Bad)
   05160 Hepatitis C
    110326250 (Bad)
   05162 Measles
    110326250 (Bad)
   05168 Herpes simplex virus 1 infection
    110326250 (Bad)
   05165 Human papillomavirus infection
    110326250 (Bad)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110326250 (Bad)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110326250 (Bad)
   01524 Platinum drug resistance
    110326250 (Bad)
   01522 Endocrine resistance
    110326250 (Bad)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 110326250
NCBI-ProteinID: XP_021060166
Ensembl: MGP_PahariEiJ_G0014114
LinkDB
Position
1
AA seq 204 aa
MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASAT
DRGLGPSLTEDQPGPYLAPGLLGSIVHQQGRASSNSHHGGAGAMETRSRHSSYPAGTEED
EGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQS
ASWTRIIQSWWDRNLGKGGSTPSQ
NT seq 615 nt   +upstreamnt  +downstreamnt
atgggaaccccaaagcagccctcgctggctcctgcacacgccctaggcttgaggaagtcc
gatcccggaatccggagcctggggagcgacgcgggaggaaggcggtggagaccagcagcc
cagagtatgttccagatcccagagtttgagccgagtgagcaggaagacgctagtgctaca
gataggggcctgggccctagcctcactgaggaccagccaggtccctacctggccccaggt
ctcctggggagcatcgttcatcaacagggacgggcatcttccaacagtcatcatggaggc
gctggggctatggagacccggagtcgccacagttcgtacccagcggggaccgaggaggat
gaagggatggaggaggagcttagcccttttcgaggacgctcgcgttcggctccccccaat
ctctgggcagcgcagcgctacggccgtgagctccgaaggatgagcgatgagtttgagggt
tccttcaagggacttcctcgcccaaagagcgcaggcactgcaacacagatgcgacaaagc
gccagctggacgcgcattatccagtcctggtgggatcgaaacttgggcaaaggaggctcc
accccctcccagtga

DBGET integrated database retrieval system