KEGG   Mus pahari (shrew mouse): 110326378
Entry
110326378         CDS       T05929                                 

Definition
(RefSeq) transforming protein RhoA-like isoform X1
  KO
K04513  Ras homolog gene family, member A
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04144  Endocytosis
mpah04150  mTOR signaling pathway
mpah04270  Vascular smooth muscle contraction
mpah04310  Wnt signaling pathway
mpah04350  TGF-beta signaling pathway
mpah04360  Axon guidance
mpah04510  Focal adhesion
mpah04520  Adherens junction
mpah04530  Tight junction
mpah04611  Platelet activation
mpah04621  NOD-like receptor signaling pathway
mpah04625  C-type lectin receptor signaling pathway
mpah04660  T cell receptor signaling pathway
mpah04670  Leukocyte transendothelial migration
mpah04722  Neurotrophin signaling pathway
mpah04810  Regulation of actin cytoskeleton
mpah04921  Oxytocin signaling pathway
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04972  Pancreatic secretion
mpah05100  Bacterial invasion of epithelial cells
mpah05132  Salmonella infection
mpah05133  Pertussis
mpah05135  Yersinia infection
mpah05152  Tuberculosis
mpah05163  Human cytomegalovirus infection
mpah05200  Pathways in cancer
mpah05203  Viral carcinogenesis
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05210  Colorectal cancer
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    110326378
   04015 Rap1 signaling pathway
    110326378
   04310 Wnt signaling pathway
    110326378
   04350 TGF-beta signaling pathway
    110326378
   04072 Phospholipase D signaling pathway
    110326378
   04071 Sphingolipid signaling pathway
    110326378
   04024 cAMP signaling pathway
    110326378
   04022 cGMP-PKG signaling pathway
    110326378
   04150 mTOR signaling pathway
    110326378
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110326378
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110326378
   04520 Adherens junction
    110326378
   04530 Tight junction
    110326378
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110326378
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110326378
   04621 NOD-like receptor signaling pathway
    110326378
   04625 C-type lectin receptor signaling pathway
    110326378
   04660 T cell receptor signaling pathway
    110326378
   04670 Leukocyte transendothelial migration
    110326378
   04062 Chemokine signaling pathway
    110326378
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    110326378
   04928 Parathyroid hormone synthesis, secretion and action
    110326378
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110326378
  09154 Digestive system
   04972 Pancreatic secretion
    110326378
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110326378
  09158 Development and regeneration
   04360 Axon guidance
    110326378
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110326378
   05206 MicroRNAs in cancer
    110326378
   05205 Proteoglycans in cancer
    110326378
   05203 Viral carcinogenesis
    110326378
  09162 Cancer: specific types
   05210 Colorectal cancer
    110326378
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110326378
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110326378
   05135 Yersinia infection
    110326378
   05133 Pertussis
    110326378
   05152 Tuberculosis
    110326378
   05100 Bacterial invasion of epithelial cells
    110326378
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110326378
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110326378
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110326378
   04031 GTP-binding proteins [BR:mpah04031]
    110326378
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    110326378
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110326378
  Exosomal proteins of other body fluids (saliva and urine)
   110326378
  Exosomal proteins of colorectal cancer cells
   110326378
  Exosomal proteins of bladder cancer cells
   110326378
GTP-binding proteins [BR:mpah04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    110326378
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 110326378
NCBI-ProteinID: XP_021060426
LinkDB
Position
9
AA seq 181 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNEKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRVALQ
A
NT seq 546 nt   +upstreamnt  +downstreamnt
atggctgccatcaggaagaaactggtgattgttggtgatggagcttgtggtaagacatgc
ttgctcatagtcttcagcaaggaccagttcccagaggtctatgtgcccacagtgtttgaa
aactatgtggcggatatcgaagtggatgggaagcaggtagagttggctttatgggacaca
gctggacaggaagattatgaccgcctgaggcctctctcttatccagacactgatgttata
ttgatgtgtttttccattgacagccctgatagtttagaaaacatcccagaaaaatggact
ccagaagtcaagcacttctgtccaaatgtgcccatcatcctggttgggaacgagaaggac
cttcggaatgatgagcacacaagacgggagttagccaaaatgaagcaggagccggtaaaa
cctgaagaaggcagagatatggcaaacaggattggcgcttttgggtacatggagtgttca
gcaaagaccaaagatggagtgagagaggtttttgagatggccacaagagttgctttgcaa
gcttga

KEGG   Mus pahari (shrew mouse): 110327907
Entry
110327907         CDS       T05929                                 

Gene name
Rhoa
Definition
(RefSeq) transforming protein RhoA isoform X1
  KO
K04513  Ras homolog gene family, member A
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04144  Endocytosis
mpah04150  mTOR signaling pathway
mpah04270  Vascular smooth muscle contraction
mpah04310  Wnt signaling pathway
mpah04350  TGF-beta signaling pathway
mpah04360  Axon guidance
mpah04510  Focal adhesion
mpah04520  Adherens junction
mpah04530  Tight junction
mpah04611  Platelet activation
mpah04621  NOD-like receptor signaling pathway
mpah04625  C-type lectin receptor signaling pathway
mpah04660  T cell receptor signaling pathway
mpah04670  Leukocyte transendothelial migration
mpah04722  Neurotrophin signaling pathway
mpah04810  Regulation of actin cytoskeleton
mpah04921  Oxytocin signaling pathway
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04972  Pancreatic secretion
mpah05100  Bacterial invasion of epithelial cells
mpah05132  Salmonella infection
mpah05133  Pertussis
mpah05135  Yersinia infection
mpah05152  Tuberculosis
mpah05163  Human cytomegalovirus infection
mpah05200  Pathways in cancer
mpah05203  Viral carcinogenesis
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05210  Colorectal cancer
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    110327907 (Rhoa)
   04015 Rap1 signaling pathway
    110327907 (Rhoa)
   04310 Wnt signaling pathway
    110327907 (Rhoa)
   04350 TGF-beta signaling pathway
    110327907 (Rhoa)
   04072 Phospholipase D signaling pathway
    110327907 (Rhoa)
   04071 Sphingolipid signaling pathway
    110327907 (Rhoa)
   04024 cAMP signaling pathway
    110327907 (Rhoa)
   04022 cGMP-PKG signaling pathway
    110327907 (Rhoa)
   04150 mTOR signaling pathway
    110327907 (Rhoa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110327907 (Rhoa)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110327907 (Rhoa)
   04520 Adherens junction
    110327907 (Rhoa)
   04530 Tight junction
    110327907 (Rhoa)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110327907 (Rhoa)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110327907 (Rhoa)
   04621 NOD-like receptor signaling pathway
    110327907 (Rhoa)
   04625 C-type lectin receptor signaling pathway
    110327907 (Rhoa)
   04660 T cell receptor signaling pathway
    110327907 (Rhoa)
   04670 Leukocyte transendothelial migration
    110327907 (Rhoa)
   04062 Chemokine signaling pathway
    110327907 (Rhoa)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    110327907 (Rhoa)
   04928 Parathyroid hormone synthesis, secretion and action
    110327907 (Rhoa)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110327907 (Rhoa)
  09154 Digestive system
   04972 Pancreatic secretion
    110327907 (Rhoa)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110327907 (Rhoa)
  09158 Development and regeneration
   04360 Axon guidance
    110327907 (Rhoa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110327907 (Rhoa)
   05206 MicroRNAs in cancer
    110327907 (Rhoa)
   05205 Proteoglycans in cancer
    110327907 (Rhoa)
   05203 Viral carcinogenesis
    110327907 (Rhoa)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110327907 (Rhoa)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110327907 (Rhoa)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110327907 (Rhoa)
   05135 Yersinia infection
    110327907 (Rhoa)
   05133 Pertussis
    110327907 (Rhoa)
   05152 Tuberculosis
    110327907 (Rhoa)
   05100 Bacterial invasion of epithelial cells
    110327907 (Rhoa)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110327907 (Rhoa)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110327907 (Rhoa)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110327907 (Rhoa)
   04031 GTP-binding proteins [BR:mpah04031]
    110327907 (Rhoa)
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    110327907 (Rhoa)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110327907 (Rhoa)
  Exosomal proteins of other body fluids (saliva and urine)
   110327907 (Rhoa)
  Exosomal proteins of colorectal cancer cells
   110327907 (Rhoa)
  Exosomal proteins of bladder cancer cells
   110327907 (Rhoa)
GTP-binding proteins [BR:mpah04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    110327907 (Rhoa)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU VASP_tetra SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 110327907
NCBI-ProteinID: XP_021062838
LinkDB
Position
10
AA seq 305 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEXGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVLWTLYIVVPDSLENIPEKWTPEVKHFCPNVPIILVGNXKDLRNDEHTR
RELAKMKQEPVKPEXGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKS
GCLVL
NT seq 918 nt   +upstreamnt  +downstreamnt
atggctgccatcaggaagaaactggtgattgttggtgatggagcttgtggtaagacatgc
ttgctcatagtcttcagcaaggaccagttcccagaggtctatgtacccacagtgtttgaa
aactatgtggcggatattgaggtggatgggaaacaggtagagttggctttatgggacaca
gctggacaggaagattatgaccgcctgaggcctctctcttatccagacactgatgttata
ttgatgtgtttttccattgacagccctgatagtttagaaaacatcccagaaaaatggact
ccagaagtcaagcacttctgtccaaatgtgcccatcatcctggttgggaacaagaaggac
cttcggaatgatgagcacacaagacgggagttagccaaaatgaagcaggagccggtaaaa
cctgaaganggcagagatatggcaaacaggattggngcttttgggtacatggagtgttca
gcaaagaccaaagatggagtgagagaggtttttgagatggccacgagagctgctctgcaa
gctcgacgtgggaagaaaaagtctgggtgccttgtcttgtggacgttgtacatcgtggtg
ccagatagtttagaaaacatcccagaaaaatggactccagaagtcaagcacttctgtcca
aatgtgcccatcatcctggttgggaacnagaaggaccttcggaatgatgagcacacaaga
cgggagttagccaaaatgaagcaggagccggtaaaacctgaaganggcagagatatggca
aacaggattggngcttttgggtacatggagtgttcagcaaagaccaaagatggagtgaga
gaggtttttgagatggccacgagagctgctctgcaagctcgacgtgggaagaaaaagtct
gggtgccttgtcttgtga

DBGET integrated database retrieval system