KEGG   Mus pahari (shrew mouse): 110326428
Entry
110326428         CDS       T05929                                 

Gene name
Foxo3
Definition
(RefSeq) forkhead box protein O3
  KO
K09408  forkhead box protein O3
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah04062  Chemokine signaling pathway
mpah04068  FoxO signaling pathway
mpah04137  Mitophagy - animal
mpah04151  PI3K-Akt signaling pathway
mpah04152  AMPK signaling pathway
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04218  Cellular senescence
mpah04722  Neurotrophin signaling pathway
mpah04917  Prolactin signaling pathway
mpah05213  Endometrial cancer
mpah05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    110326428 (Foxo3)
   04151 PI3K-Akt signaling pathway
    110326428 (Foxo3)
   04152 AMPK signaling pathway
    110326428 (Foxo3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    110326428 (Foxo3)
  09143 Cell growth and death
   04218 Cellular senescence
    110326428 (Foxo3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    110326428 (Foxo3)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    110326428 (Foxo3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110326428 (Foxo3)
  09149 Aging
   04211 Longevity regulating pathway
    110326428 (Foxo3)
   04213 Longevity regulating pathway - multiple species
    110326428 (Foxo3)
 09160 Human Diseases
  09162 Cancer: specific types
   05213 Endometrial cancer
    110326428 (Foxo3)
   05223 Non-small cell lung cancer
    110326428 (Foxo3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110326428 (Foxo3)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    110326428 (Foxo3)
SSDB
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 110326428
NCBI-ProteinID: XP_021060511
Ensembl: MGP_PahariEiJ_G0030695
LinkDB
Position
9
AA seq 672 aa
MAEAPASPVPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEE
DDDEDDEDGGGRASSAMVIGGGVSSTLGSGLLLEDSAMLLAPGGQDLGSGPASAAGALSG
GTPTQLQPQQPLPPPQPGAAGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTLS
QIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGG
KSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQAAPESADDSPSQLSKWPGSPTSRSSD
ELDAWTDFRSRTNSNASTVSGRLSPILASTELDDVQDDDGPLSPMLYSSSASLSPSVNKP
CTVELPRLTDMAGTMNLNDGLAENLMDDLLDNIALPPSQPSPPGGLMQRGSSFPYTAKSS
GLGSPTGSFNSTVFGPSSLNSLRQSPMQTIQENRPATFSSVSHYGNQTLQDLLASDSLSH
SDVMMTQSDPLMSQASTAVSAQNARRNVMLRNDPMMSFAAQPTQGSLVNQNLLHHQHQTQ
GALGGSRALSNSVSNMGLSDSSSLGSAKHQQQSPASQSMQTLSDSLSGSPLYSASANLPV
MGHDRFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFTG
AKQASSQSWVPG
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggcagaggcaccagcctccccggtcccgctctctccgctcgaagtggagctggaccca
gagttcgagccacagagtcggccacgctcctgtacgtggcccctgcagaggccggagttg
caggcgagcccggccaagccctcgggggagacggccgcagactccatgatccccgaggag
gacgacgatgaagacgacgaggacggcggcggccgagccagctcggccatggtgatcggt
ggcggcgtgagcagcacgctgggctccgggctgctcctcgaggattcggccatgctgctg
gctccaggagggcaggacctcgggtccgggccagcctccgccgcaggcgcgctgagtggg
ggcacgccgacgcagctgcagcctcagcagccactgccaccgccgcagccgggggcggct
gggggctctgggcaaccaaggaaatgctcctcgcggcggaatgcctgggggaacctgtcc
tacgccgacctgatcacccgcgctatcgagagctccccggacaaacggctcactttgtcc
cagatctacgagtggatggtgcgctgtgtgccctacttcaaggataagggcgacagcaac
agctctgcgggctggaagaactccatccggcacaacttgtccctgcacagccgattcatg
cgagttcagaatgaaggcactggcaagagctcttggtggatcatcaaccccgatggggga
aagagcgggaaggccccccggcggcgtgctgtctccatggacaacagcaacaagtacacc
aagagccgaggccgggcagccaagaagaaggcggccctgcaggctgccccagagtcagca
gacgacagtccatcccagctctccaagtggcctggtagccccacgtcccgcagcagcgat
gagctggatgcgtggaccgacttccgctcgcgcaccaattccaacgccagcaccgtgagc
ggccgcctgtcacccatcctggcaagcacggagctagatgacgtccaggacgatgatgga
cccctgtcccccatgctgtacagcagctctgccagcctgtcgccttctgtgaacaagcca
tgtactgtggagcttccgcggctgacagacatggccggcaccatgaatctgaacgacggg
ctggccgagaacctcatggacgacctgctagataacatcgcgctaccgccatcgcagcca
tcgcctcccggcgggctaatgcaacgaggctccagcttcccgtataccgccaagagctcc
ggcctgggctccccaaccggctccttcaacagtaccgtgtttggaccttcgtctctgaac
tccttgcgccagtcacccatgcagaccatccaggagaacagacccgccaccttctcttcc
gtgtcacactacggcaaccagacactccaagacctgctcgcttcagactcactcagccac
agcgatgtcatgatgacccagtcagaccccttgatgtctcaggctagcaccgccgtgtct
gcccagaatgcccgccggaacgtgatgcttcgcaacgacccaatgatgtcctttgctgcc
cagcctacccaggggagtttggtcaatcagaacttgctccaccaccagcaccaaacccag
ggcgctcttggtggcagccgtgccttgtcaaattccgtcagcaacatgggcttgagtgac
tccagcagccttggctcagccaaacaccagcagcagtctcccgccagccagtctatgcaa
accctctcagactctctctcaggctccccactgtattcagctagtgcaaaccttcccgtc
atgggccatgataggttccccagtgacttggacctggacatgttcaatgggagcttggaa
tgtgacatggagtccatcatccgtagtgaacttatggatgcggatgggttggattttaac
tttgactccctcatctccacacagaacgttgttggtttgaacgtggggaacttcactggt
gctaagcaggcctcatctcaaagctgggtaccaggctga

DBGET integrated database retrieval system