KEGG   Mus pahari (shrew mouse): 110326926
Entry
110326926         CDS       T05929                                 

Gene name
Itgb2
Definition
(RefSeq) integrin beta-2
  KO
K06464  integrin beta 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04015  Rap1 signaling pathway
mpah04145  Phagosome
mpah04390  Hippo signaling pathway
mpah04514  Cell adhesion molecules
mpah04610  Complement and coagulation cascades
mpah04613  Neutrophil extracellular trap formation
mpah04650  Natural killer cell mediated cytotoxicity
mpah04670  Leukocyte transendothelial migration
mpah04810  Regulation of actin cytoskeleton
mpah05133  Pertussis
mpah05134  Legionellosis
mpah05140  Leishmaniasis
mpah05144  Malaria
mpah05146  Amoebiasis
mpah05150  Staphylococcus aureus infection
mpah05152  Tuberculosis
mpah05166  Human T-cell leukemia virus 1 infection
mpah05323  Rheumatoid arthritis
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110326926 (Itgb2)
   04390 Hippo signaling pathway
    110326926 (Itgb2)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110326926 (Itgb2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110326926 (Itgb2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110326926 (Itgb2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110326926 (Itgb2)
   04613 Neutrophil extracellular trap formation
    110326926 (Itgb2)
   04650 Natural killer cell mediated cytotoxicity
    110326926 (Itgb2)
   04670 Leukocyte transendothelial migration
    110326926 (Itgb2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110326926 (Itgb2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    110326926 (Itgb2)
   05134 Legionellosis
    110326926 (Itgb2)
   05150 Staphylococcus aureus infection
    110326926 (Itgb2)
   05152 Tuberculosis
    110326926 (Itgb2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110326926 (Itgb2)
   05144 Malaria
    110326926 (Itgb2)
   05140 Leishmaniasis
    110326926 (Itgb2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    110326926 (Itgb2)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110326926 (Itgb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110326926 (Itgb2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110326926 (Itgb2)
   04515 Cell adhesion molecules [BR:mpah04515]
    110326926 (Itgb2)
   04090 CD molecules [BR:mpah04090]
    110326926 (Itgb2)
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    110326926 (Itgb2)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110326926 (Itgb2)
Cell adhesion molecules [BR:mpah04515]
 Integrins
  Integrin beta subunits
   110326926 (Itgb2)
CD molecules [BR:mpah04090]
 Proteins
  110326926 (Itgb2)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 110326926
NCBI-ProteinID: XP_021061241
Ensembl: MGP_PahariEiJ_G0030896
LinkDB
Position
9
AA seq 770 aa
MLSPHSLLLALAGLSFLGSAVSQECTKYKVSNCQDCIQSGPGCSWCQKLNFTGPGEPDSL
RCDTRAQLLLKGCPADDIVDPRSIADPEFDQRGQRKQLSPQKVTLYLRPGQAAAFNVTFR
RAKGYPIDLYYLMDLSYSMLDDLNNVKKLGGDLLQALNEITESGRIGFGSFVDKTVLPFV
NTHPEKLRNPCPNKEKACQPPFAFRHVLKLTDNSNQFQTEVGKQLISGNLDAPEGGLDAI
MQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNMYKRSNEFD
YPSVGQLAHKLSESNIQPIFAVTKKMVKTYEKLTEIIPKSAVGELSDDSSNVVQLIKNAY
YKLSSRVFLDHSTLPDTLKVTYDSFCSNGASSIGKSRGDCDGVQINNPVTFQVKVTASEC
IQEQSFVIRALGFTDTVTVQVRPQCECQCQDQSREQNLCGGKGVMECGICRCESGYIGKN
CECQTQGRSSQELERNCRKDNSSIVCSGFGDCICGQCMCHTSDVPNKKIYGQYCECDNVN
CERYDSQVCGGSGRGSCYCGKCNCEKGFEGSACQCERSTTGCLNARLVECSGRGRCQCNR
CICDEGYQPPMCEECPSCTSHCIDNHTSCAECLKFDKGPFEKNCSVQCAGMTLQTIPLKR
KPCKERDSEGCWITYTLQQKDGRNNYNIHVEDSRECVKGPNVAAIVGGTVVGVVLIGVLL
LVIWKALTHLTDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES
NT seq 2313 nt   +upstreamnt  +downstreamnt
atgctgagcccacactcactgctgcttgccctagctggactgtcattcctgggatctgct
gtgtcccaggaatgcaccaagtacaaagtcagcaactgccaggactgtatccagtcgggg
cctggctgttcctggtgccagaagctgaacttcactggaccaggggaacctgactccttg
cgctgtgacacacgggcacagctgctgctgaagggttgtccagccgatgatatcgtggac
cccaggagcatcgctgatcccgagtttgaccaacgggggcaacggaagcagctatctcca
caaaaagtgacactttacttgcgaccagggcaggctgctgcattcaatgtgactttccgg
cgggccaagggctaccccattgatctgtactacctcatggatctctcctactccatgctt
gatgacctcaataacgtcaagaagctgggtggggacttgctgcaggccctcaacgagatc
accgagtctggccgcatcggctttgggtcctttgtggacaagacggtgctgccttttgtc
aacacccatcctgagaagctgaggaacccatgtcccaacaaggagaaggcctgccagccc
ccgtttgcctttcggcacgtgctcaagctaaccgacaactccaaccagtttcagacagag
gttggcaagcaactgatttccggaaacctggacgcccctgagggcgggctggatgccata
atgcaagttgctgcgtgtccggaggaaattggctggcgcaatgtcacgaggctgctggtg
tttgccacagacgacggcttccactttgctggtgatggcaagctgggtgctatcctgacc
cccaatgatggccgctgccacctggaggataacatgtacaagaggagcaatgagttcgac
tacccatccgtgggccagctggctcacaaactttccgaaagcaacatccaacccatcttt
gcggtgacaaagaagatggtgaaaacttatgagaaactcacagagattatccccaagtca
gcagtgggggaactgtctgacgactccagcaacgtggtacagctcatcaagaatgcctac
tacaaactctcctctagagtcttcctggaccacagcaccctcccggacaccctgaaagtc
acctatgactccttctgcagtaatggagcatcgagtataggcaaatcccgaggggactgt
gatggcgtgcagatcaacaacccggtcaccttccaagtaaaggtcacggcttcagagtgt
atccaggagcagtcctttgtcatccgggcactgggtttcacggatacagtgaccgtgcag
gtccgtccccagtgtgaatgtcagtgccaggaccagagtcgggagcagaatctctgtgga
ggcaagggagtcatggaatgtggcatctgcaggtgtgagtctggctacattgggaaaaac
tgtgagtgccagactcagggtcgaagcagccaggagctggagagaaactgtcggaaggac
aatagttccatcgtgtgctcagggtttggggactgcatctgtgggcagtgtatgtgccac
accagtgacgtcccaaacaaaaagatctacgggcaatactgcgagtgtgacaatgtcaac
tgtgaaagatatgacagccaggtctgcggtggctcaggtaggggttcctgctactgtggc
aaatgtaattgcgagaagggtttcgagggctcggcctgccagtgtgagaggtccaccaca
ggctgtctgaatgcacggctggtagagtgcagtggccgtggccggtgccaatgcaacagg
tgcatatgtgatgaaggctaccagccaccgatgtgtgaggagtgtcctagctgcacctcg
cactgcattgacaaccacacctcttgtgccgagtgcctgaagtttgataagggccctttt
gagaagaactgtagtgttcagtgtgccggtatgacgctgcagactatccctttgaagaga
aagccctgcaaggagagggactcagaaggctgctggataacttacactttgcagcagaag
gatggaaggaacaattacaacatccatgtggaggacagtcgagagtgtgtgaagggcccc
aacgtggctgctatcgtagggggcaccgtggtgggtgtcgtactgattggtgtcctcctc
ctggtcatctggaaggccctgacccacctaactgacctcagggagtacaggcgctttgag
aaggagaaactcaagtcccagtggaacaatgataaccccctcttcaagagtgctaccaca
accgtcatgaaccccaagtttgctgaaagctag

KEGG   Mus pahari (shrew mouse): 110330040
Entry
110330040         CDS       T05929                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: integrin beta-2-like protein
  KO
K06464  integrin beta 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04015  Rap1 signaling pathway
mpah04145  Phagosome
mpah04390  Hippo signaling pathway
mpah04514  Cell adhesion molecules
mpah04610  Complement and coagulation cascades
mpah04613  Neutrophil extracellular trap formation
mpah04650  Natural killer cell mediated cytotoxicity
mpah04670  Leukocyte transendothelial migration
mpah04810  Regulation of actin cytoskeleton
mpah05133  Pertussis
mpah05134  Legionellosis
mpah05140  Leishmaniasis
mpah05144  Malaria
mpah05146  Amoebiasis
mpah05150  Staphylococcus aureus infection
mpah05152  Tuberculosis
mpah05166  Human T-cell leukemia virus 1 infection
mpah05323  Rheumatoid arthritis
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110330040
   04390 Hippo signaling pathway
    110330040
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110330040
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110330040
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110330040
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110330040
   04613 Neutrophil extracellular trap formation
    110330040
   04650 Natural killer cell mediated cytotoxicity
    110330040
   04670 Leukocyte transendothelial migration
    110330040
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110330040
  09171 Infectious disease: bacterial
   05133 Pertussis
    110330040
   05134 Legionellosis
    110330040
   05150 Staphylococcus aureus infection
    110330040
   05152 Tuberculosis
    110330040
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110330040
   05144 Malaria
    110330040
   05140 Leishmaniasis
    110330040
  09163 Immune disease
   05323 Rheumatoid arthritis
    110330040
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110330040
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110330040
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110330040
   04515 Cell adhesion molecules [BR:mpah04515]
    110330040
   04090 CD molecules [BR:mpah04090]
    110330040
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    110330040
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110330040
Cell adhesion molecules [BR:mpah04515]
 Integrins
  Integrin beta subunits
   110330040
CD molecules [BR:mpah04090]
 Proteins
  110330040
SSDB
Motif
Pfam: Integrin_beta PSI_integrin EGF_2 I-EGF_1
Other DBs
NCBI-GeneID: 110330040
NCBI-ProteinID: XP_021065627
Ensembl: MGP_PahariEiJ_G0016710
LinkDB
Position
12
AA seq 735 aa
MLGQCTLLPVLAGLLSLGSALSQLCATDNVSTCQDCIRSGPSCAWCQKLNFTGRGEPDSV
HCGTPEQLLLRGCTSEYLVDPKSLAEPQEDKERDQRQLSPRNVTVFLRPGQAATFKVDFQ
RTQDTSVDLYFLMGLSGFVQGHLFNVQTLGSDLLKALNEISRSGRIGFGSIMNMTFQHIL
KLNADSSQFQRELRKQLVSGKLAIPKGQLDAMVQVAVCLGEIGWRNGTRFLVLVTDHDFH
LAKDKTPGTRRNTSDGRCHLEDGMYRSRREPDYQSVVQLASKLAENNIQPIFVVPSRMVK
TYEELTTFIPKLTIGELSDDSSNVAQLIRNAYSKLSSRVLLNHSTIPSILKVTYDSYCSN
GTSSTGKSSGDCSNVQINDQVTFQVNVTASECFRKQFFFIQALGFTDSVTVRVLPLCECQ
CQEQSQHHSLCGGKGAMECGICRCNSGYVGKNCECQTQGRSSQDLEGSCRKDNSSIMCSG
LGDCICGQCECHTSDIPNKVIYGQYCECDNVNCERYDGQVCGGPSRGLCSCGLCICHDSF
EGSACQLRTSTLGCLNDRMVECSGHGQCHFNRCLCDPGYQPPLCKKFHRCSEYYSCARCL
KDNSAIRCSVCWNLVFSNTPFNDKTCITEPDSEGCRITYTLYQPDRSDINSIYIKDSRVC
TETSSATILLGVIVGVLLAVIFLLVYCMVSLKETQKAPKLSRKDGVQSTLAQQEPHFQEH
HHEEPXWNQERQGTQ
NT seq 2208 nt   +upstreamnt  +downstreamnt
atgctgggccagtgcactctgctacctgtcctggctgggctgctgtctctgggatctgct
ctgtcccagttgtgtgccacggacaatgtgagcacctgtcaggactgtatccggtcaggg
cccagctgtgcctggtgccagaagctgaacttcacagggcgaggggagcccgactcagtt
cactgtggtactccagagcaactgttgctgagaggctgcacatctgagtacctcgtggac
cccaagagtcttgctgaaccccaggaggacaaggagagggaccagaggcagctgtcccca
cgaaatgtgacagttttcttgagaccaggtcaagcggcaacattcaaagtggacttccag
cggacccaggacacctctgttgacctgtacttcctgatgggcctctctggctttgtgcaa
ggccacctcttcaatgtccagacattgggcagtgacctgctcaaagccctcaatgagatc
tccaggtcaggccgaatcggctttggatccatcatgaacatgaccttccagcacatcctg
aagctgaatgcggactcaagccaatttcagagggagctgaggaagcaactggtttctgga
aagctggctatccccaagggacagctagacgctatggtgcaagttgccgtgtgcctggga
gaaattggctggcgcaatgggacccggtttctggtgcttgttaccgaccatgatttccac
ttggctaaagacaagactccgggtaccagacggaacaccagtgatggtcgctgtcacctg
gaagatggcatgtacaggagcaggagagaacctgactatcagtcagtggtccagctggcg
agcaaactggctgaaaacaacatccaacccatctttgtggtgccctcgaggatggtgaaa
acctatgaggaacttaccacattcatccccaagctgaccattggggagctgtcagatgac
tccagcaacgtggcacagctcatcaggaatgcctacagtaaactctcctccagagttctc
ctgaaccacagcaccatccccagcatcctgaaagttacctacgactcctactgcagcaat
ggaacatcaagtacaggaaaatccagcggggactgcagtaatgtgcagatcaatgaccag
gtcaccttccaggttaatgtcacagcttcagagtgcttccggaagcagttctttttcatc
caggcactggggttcacggattcagtgactgtgcgggtccttcccctctgtgaatgccag
tgtcaggagcagagtcaacaccacagcctctgtggaggcaagggtgccatggagtgtggc
atctgcaggtgcaactctggctatgttgggaaaaactgtgagtgccagacacagggccgg
agcagccaggatctggagggaagctgccggaaggacaatagttccatcatgtgctcaggg
ctgggggactgtatctgtgggcagtgtgagtgccacaccagtgacatccccaacaaagtg
atctatggacaatactgcgagtgtgacaatgtcaactgtgagagatatgacggccaagtc
tgcggtggcccaagtagaggcctctgctcctgtggtctatgcatttgccatgacagcttt
gagggctcagcctgccagctccggacgtccactttgggctgtctgaacgacaggatggtg
gagtgcagtggccatggtcaatgccactttaacagatgcctctgtgacccgggctaccaa
ccaccactgtgtaagaagttccatcgctgctccgagtactactcctgtgccaggtgcttg
aaagacaacagtgcaataagatgcagtgtgtgttggaatcttgtgttttctaacaccccc
ttcaatgacaagacctgcataactgaaccagactcagagggctgccggataacctacact
ctatatcagccagaccggagtgacatcaattccatctacataaaggatagccgagtgtgt
acagaaacctccagtgccaccatcctactgggcgttatagtgggcgtcctgctggctgtt
atcttcctgctggtttactgtatggtttccctgaaggaaacccagaaggctcccaagctc
tccagaaaggatggggttcaaagcacactggcacagcaggagcctcatttccaagaacac
caccatgaggagccantgtggaatcaagagagacagggtacccagtga

DBGET integrated database retrieval system