KEGG   Mus pahari (shrew mouse): 110327431
Entry
110327431         CDS       T05929                                 

Gene name
Mlh1
Definition
(RefSeq) DNA mismatch repair protein Mlh1 isoform X1
  KO
K08734  DNA mismatch repair protein MLH1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01524  Platinum drug resistance
mpah03430  Mismatch repair
mpah03460  Fanconi anemia pathway
mpah05200  Pathways in cancer
mpah05210  Colorectal cancer
mpah05213  Endometrial cancer
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    110327431 (Mlh1)
   03460 Fanconi anemia pathway
    110327431 (Mlh1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110327431 (Mlh1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110327431 (Mlh1)
   05226 Gastric cancer
    110327431 (Mlh1)
   05213 Endometrial cancer
    110327431 (Mlh1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110327431 (Mlh1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mpah03400]
    110327431 (Mlh1)
DNA repair and recombination proteins [BR:mpah03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     110327431 (Mlh1)
SSDB
Motif
Pfam: Mlh1_C DNA_mis_repair HATPase_c_3 HATPase_c Hfx_Cass5
Other DBs
NCBI-GeneID: 110327431
NCBI-ProteinID: XP_021062071
Ensembl: MGP_PahariEiJ_G0015622
LinkDB
Position
10
AA seq 758 aa
MAFVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTNIQVVVKEGGLKLIQ
IQDNGTGIRKEDMDIVCERFTTSKLQTFEDLASISTYGFRGEALASISHVAHVTITTKTA
DGKCAYRASYSDGKLQAPPKPCAGNQGTLITVEDLFYNIITRRKALKNPSEEYGKILEVV
GRYSIHNSGISFSVKKQGETVSDVRTLPNATTVDNIRSIFGNAVSRELIEVGCEDKTLAF
KMNGYISNANYSVKKCIFLLFINHRLVESAALRKAIETVYAAYLPKNTHPFLYLSLEISP
QNVDVNVHPTKHEVHFLHEESILQRVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEAV
KPTTGVASSATSGSGDKVYAYQMVRTDSRDQKLDAFLQPVSSLQPSQPQDPVRGDGTEGP
PEKAMRKDEEMLELPAPAEAAAESENLERESVIGTSDAAQKAAPTSSPGSSRKRHREDSD
VEMVENDSGKEMTAACYPRRRIINLTSVLSLQEEITERGHETLREMLRNHSFVGCVNPQW
ALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEAAPLFDLAMLALDSPESGWT
EEDGPKEGLAEYIVEFLKKKAEMLADYFSVEIDEEGNLIGLPLLIDSYVPPLEGLPIFIL
RLATEVNWDEEKECFESLSKECAMFYSIRKQYILEESSLSGHQSDMPGSTSKPWKWTVEH
IIYKAFRSHLLPPKHFTEDGNVLQLANLPDLYKVFERC
NT seq 2277 nt   +upstreamnt  +downstreamnt
atggcgtttgtagccggagttattcggcgcctggacgagacggtagtgaaccgcatagcg
gcgggggaagtcattcagcggccggccaatgctatcaaagagatgattgaaaactgttta
gatgcaaaatctacaaatattcaagtggttgttaaagaaggaggcctgaagctaattcag
atccaagacaacggcactggaatcaggaaggaggatatggatattgtgtgtgagaggttc
actacgagtaaactgcagacttttgaggatttagccagtatttctacctatggctttcgt
ggtgaggcgttggcaagcataagccatgtggcccatgtcactattacaaccaaaacagct
gatgggaaatgtgcatacagagcaagttactcagatggaaagctgcaagcccctcctaaa
ccctgtgcaggcaaccagggtaccctgatcacggtggaagaccttttttacaacataatc
acaaggaggaaagctttaaaaaatccaagtgaagagtacggaaaaattttggaagttgtt
ggcaggtattcaatacacaattcaggcattagtttctcagttaaaaaacaaggtgagaca
gtatctgatgtcagaacactgcccaatgccacaaccgtggacaacattcgctccatcttt
ggaaatgctgttagtcgagaactgatagaagttgggtgtgaggataaaaccctagctttc
aaaatgaatggctatatatcaaatgcaaactactcagtgaagaagtgcattttcctactc
ttcatcaaccaccgtctggtagaatcagctgccttgagaaaagccatagaaactgtatat
gcagcatatttgcccaaaaacacacacccattcctgtacctcagtttggaaatcagccct
cagaatgtggacgtcaatgtacaccccaccaagcacgaagttcactttctgcacgaggag
agcattctgcagcgagtgcagcagcacattgagagcaagctgctgggctccaattcctcc
aggatgtatttcacccagaccttgcttccaggacttgctggtccctctggggaggcagtt
aagcccacgacaggtgtggcttcctcggctactagtggaagtggcgacaaggtctacgct
taccagatggtccgtacggactcccgggaccagaagcttgacgcctttctgcagcctgta
agcagccttcagcccagccagccccaggaccctgtccgaggagacgggacagagggccct
cctgaaaaggccatgcggaaggacgaggagatgcttgagctcccagcccccgctgaagca
gctgctgagagcgagaacttggagagggaatcagtgatagggacttcagacgcagcacag
aaagccgcacccacttccagtccaggcagctccagaaagagacaccgggaggactctgat
gtggaaatggtggaaaatgattccgggaaggaaatgacagctgcttgctacccccggagg
aggatcattaacctcaccagcgttttgagtctccaggaagaaattactgagcggggccat
gagactctccgggagatgctccgaaaccattcctttgtgggctgtgtgaatcctcagtgg
gccttggcccagcaccagaccaagctgtacctcctcaacactaccaagctcagtgaagag
ctgttctaccagatactcatttatgattttgccaactttggtgttctgaggttatcggaa
gcagcaccactctttgacctcgccatgctggccttagacagtcctgaaagtggctggaca
gaggaagacggcccgaaggaagggcttgcagagtacattgttgagtttctgaagaagaaa
gcggagatgcttgcagactatttctctgtggaaatcgatgaggaagggaacctgattgga
ttacctcttctgattgacagctatgtgccgcctttggagggactgcctatcttcattctt
cgactggctactgaggtgaattgggatgaagaaaaggagtgttttgaaagtctcagtaaa
gaatgtgctatgttttactccattcggaagcagtatatactggaggagtcgtccctctca
ggccatcagagtgacatgcctggctccacgtcaaagccctggaagtggactgtggaacac
attatctataaagccttccgctcacacctcctacctccgaagcatttcacagaagatggc
aatgtcctgcagcttgccaacctgccagatctatacaaagtctttgagcggtgttaa

DBGET integrated database retrieval system