KEGG   Mus pahari (shrew mouse): 110327456Help
Entry
110327456         CDS       T05929                                 

Gene name
Atm
Definition
(RefSeq) serine-protein kinase ATM isoform X1
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01524  Platinum drug resistance
mpah03440  Homologous recombination
mpah04064  NF-kappa B signaling pathway
mpah04068  FoxO signaling pathway
mpah04110  Cell cycle
mpah04115  p53 signaling pathway
mpah04210  Apoptosis
mpah04218  Cellular senescence
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05202  Transcriptional misregulation in cancer
mpah05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    110327456 (Atm)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    110327456 (Atm)
   04068 FoxO signaling pathway
    110327456 (Atm)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110327456 (Atm)
   04210 Apoptosis
    110327456 (Atm)
   04115 p53 signaling pathway
    110327456 (Atm)
   04218 Cellular senescence
    110327456 (Atm)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110327456 (Atm)
   05206 MicroRNAs in cancer
    110327456 (Atm)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110327456 (Atm)
   05170 Human immunodeficiency virus 1 infection
    110327456 (Atm)
   05165 Human papillomavirus infection
    110327456 (Atm)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110327456 (Atm)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110327456 (Atm)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mpah03032]
    110327456 (Atm)
   03400 DNA repair and recombination proteins [BR:mpah03400]
    110327456 (Atm)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110327456 (Atm)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   110327456 (Atm)
DNA replication proteins [BR:mpah03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     110327456 (Atm)
DNA repair and recombination proteins [BR:mpah03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    110327456 (Atm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC RYDR_ITPR
Motif
Other DBs
NCBI-GeneID: 110327456
NCBI-ProteinID: XP_021062119
Ensembl: MGP_PahariEiJ_G0015084
LinkDB All DBs
Position
10
AA seq 3059 aa AA seqDB search
MSLALNDLLICCRQLEHDRATERRKEVDKFKRLIQDPETVQHLDRHSDSKQGKYLNWDAV
FRFLQKYIQKETESLRTAKSNVSATTQTSRQKKMQEISSLVRYFIKCANKRAPRLKCQDL
LSYVMDTVKNSSNGVTYGADCSNILLKDILSVRKYWCEVSQQQWLELFSLYFRLYLKPSQ
DINRLLVARIIYAVTRGCCSQTDGLPSKFLDLFSKAIQYARQEKSSPGLSHILAALNIFL
KTLAVNFRKRVCEVGDEILPTLLYIWTQHRLNDSLKEVIIELIQLQIYIHHPQGAKTPEK
GAYESMKWKSILYNLYDLLVNEISHIGSRGKYSSGSRNIAVKENLIDLMADICYQLFDAD
TRSVEISQSYATQRESTDYSKPCKRRKIDIGWEVIKDYLQKSQNDFDLVPWLQITTRLIS
KYPSSLPNCELSPLILILYQLLPQQRRGERIPYVLRCLKEVALCQGKKSNLESSQKSDLL
KLWIKIWSITFRGISSGQTQTENFGLLEAIIQGSLVELDREFWKLFTGSACKPSSPSVCC
LTLALSVCVVPDAIKMGTEQSVCEANRSFSVKESIMRWLLFYQLEDDLEDSTELPPILQS
NFPHLVLEKILVSLTMKNSKAAMKFFQSVPECEQHCEDKEHSFSEVEELFLQTTFDKMDF
LTTVKENVVEKFQSSVGFSVQQHLKESLDRYLLGLSGQLLSNYSSEITSSETLVRCSSLL
VGVLGCYCYMGIITEDEAHKSELFQKAKSLMQCAGESISLFKNKTNEESRIGSLRNVIHL
CTSCLCIHTRHTPNKIASGLFLRLLTSKLMNDIADICKSLASYMKKPLDYGEVHPVKDDD
GGSGDESLMEAEGPSSTDLFSAYPASTVSDANDYGENQNAVGAMSPLTADYLSKQDHLLL
DMLRFLCLSVTASQSHTVSFRGADIRRKLLLLLDSSTLDLTKPLHLHMYLVLLKDLPGKE
HSLPMEDVVELLQPLSLVCSLHRRDQDVCKTILSNVLHIVTNLGQGSVDMESTRIAQGHF
LTVMGAFWHLTKEKKCVFSVRMALVKCLQTLLEADPYSEWAILNVKGQDFPVNEAFPQFL
ADDHHQVRMLAAGSINRLFQDMRQGDFSRSLKSLPSKFQQTSFNNAYMTAEAGIRALLCD
SQNPDLLDEIYNRKSVLLMLIAVVLHCSPVCEKQALFALCKSVKQNGLEPHLVKKVLEKV
SESFGCRSLEDFMVSHLDYLVLEWLNLQDTEYSLSSFPFMLLNYTSIEDFYRSCYKILIP
HLVIRSHFDEVKSIANQIQKCWKSLLVDCFPKILVHILPYFAYEGTGDSSVSQKRETATK
VYDTLKGEDFLGKQIDQVFISNLPEIVVELLMTLHETASADSDASQSAVLCDFSGDLDPA
PNPPYFPSHVIKATFAYISNCHKTKFKSILEILSKIPDSYQKILLAICEQAAETNNVFKK
HRILKIYYLFVSLLLKDIQSGLGGAWAFVLRDVIYTLIHYINKRSSHFTDVSLRSFSLCC
DLLSRVCHTAVTQCKDALENHLHVIVGTLIPLVDYQEVQEQVLDLLKYLVIDNKDNKNLF
VTIKLLDPFPDHVIFKDLRLTQQKIKYSGGPFSLLEEINHFLSVSAYNPLPLTRLEGLKD
LRRQLEQHKDQMLDLLKASQDNPQDGIVVKLVVSLLQLSKMAVNQTGEREVLEAVGRCLG
EIGPLDFSTIAVQHNRDASYTKAYGLPEDRELQWTLIMLTALNNTLVEDSVKVRSAAATC
LKNILATKTGHVFWENYKTSADPMLAYLQPFRTSRKKFLEVPRSVKEDVLEGLDDVNLWV
PQSESHDIWIKTLTCAFLDSGGIKSEILQLLKPMCEVKTDFCQMVLPYLIHDVLLQDTHE
SWRTLLSTHVRGFFTSCFKHSSQASRSATPANSDSESENFLRCCLDKKSQRTMLAVVDYL
RRQKRPSSGTAFDDAFWLDLNYLEVAKVAQSCSAHFTALLYAEIYSDKKSTDEQEKRSPT
FEEGSQGTTISSLSEKSKEETGISLQDLLLEIYRSIGEPDSLYGCGGGKMLQPLTRIRTY
EHEATWEKALVTYDLETSISSSTRQSGIIQALQNLGLSHILSIYLKGLDHERKEWCAELQ
ELHYQTAWRNMQWDLCGSASQEVEGTSYHESLYNALQCLRNRELSTFYESLRYARVKEVE
ELSKGSLESVYSLYPTLSRLQAIGELENSGELFSRSVTDRERSEAYLKWQKHSQLLKDSD
FSFQEPLMALRTVILEILVQKEMENSQGACSKDILTKHLVEFSVLARTFKNTQLPERAIF
KIKQYNSAICGISEWHLEEAQVFWAKKEQSLALNVLKQMIKKLDSSFKENDAALKVIHAE
CLRVCGSWLAETCLENPAVIMQTYLEKAVKVAGSYDGNSRELRNGQMKAFLSLARFSDTQ
YQRIENYMKSSEFENKQTLLKRAKEEVGLLREHKIQTNRYTVKVQRELELDECALRALKE
DRKRFLCKAVENYINCLLSGEEHDLWVFRLCSLWLENSGVSEVNGMMKKDGMKISSYKFL
PLMYQLAARMGTKMTGGLGFHEVLNNLISRISLDHPHHTLFIILALANANKDEFLSKPET
ARRSRITKSTPKENSQLDEDRTEAATKIIHSIRSKRCKMVKDMEALCDAYIILANLDASQ
WRTQRKGINIPANQPITKLKNLEDVVVPTMEIKVDPTGEYGNLVTIKSFKTEFRLAGGLN
LPKIIDCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLLQRNTETRKRKLTICTYKV
VPLSQRSGVLEWCTGTTPIGEYLVNNEEGAHKRYRPNDFSAYQCQKKMMEVQKKSFEEKY
DTFMTICQNFEPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSSIVGYILGLGDRHVQNIL
INEQSAELVHIDLGVAFEQGKILPTPETVPFRLSRDIVDGMGITGVEGVFRRCCEKTMEV
MRSSQETLLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDESDLHSTPNADDQEYKQSLSD
TDQSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLSRLFPGWKAWV
NT seq 9180 nt NT seq  +upstreamnt  +downstreamnt
atgagtctagcacttaatgatctgctcatttgctgccggcagttagaacatgacagagct
acagaacgaaggaaagaagtggataaatttaagcgcctgattcaggatcctgaaacagtt
caacatttggataggcattctgattccaaacaaggaaaatacctgaattgggatgctgtt
ttcaggtttttacagaagtacattcaaaaagaaacggaaagtctgagaacagcaaaatca
aatgtatcagccaccacacaaacctccagacagaagaagatgcaagagatcagcagtttg
gtcagatacttcatcaaatgtgcaaataaaagagcacccaggctaaaatgtcaagacctc
ttgagttatgtcatggatacagtgaaaaattcatctaacggtgtaacttatggagctgac
tgtagcaacatactactcaaagacattctttctgtgagaaaatactggtgtgaagtgtct
cagcagcagtggctagaattgttttcactgtacttcaggctgtatctcaaaccatcacag
gacattaatagacttttagtggctagaataatttatgctgtcaccagaggatgctgttca
cagactgatggattaccttcaaaatttttagatcttttttccaaggctattcagtatgcc
agacaagaaaagagctctcctggcttaagtcacatcttagcagcccttaacattttcctc
aagaccctagctgtcaacttccgaaaacgggtgtgtgaagtaggagatgaaattcttcct
accttactatatatttggactcaacatagacttaatgattctttaaaagaagtaattatt
gaactgattcaactgcaaatttatatccatcatccacaaggagccaaaactcctgaaaaa
ggtgcttatgagtccatgaaatggaaaagtatcttgtacaacttatatgacctgctagtg
aatgagataagtcatataggaagtagagggaaatattcttcaggatctcgtaatattgct
gtcaaggaaaatctgattgacctgatggcagatatctgttaccagctttttgatgcagat
accagatctgtggagatttctcagtcttatgcgacacaaagggaatccactgattacagt
aaaccttgcaaaagaaggaaaatagacataggctgggaagtgataaaagattatcttcag
aaatcacagaatgattttgatcttgtgccttggctacagattacaacccgattaatatca
aaatatccttccagtttacctaactgtgagctctctccattaatactgatactgtaccag
cttctgcctcaacagcggcgtggagaacgcatcccatatgtgttacgatgccttaaggaa
gttgctttatgtcaaggcaagaaatcaaacctagaaagctctcaaaagtcagatttattg
aaactatggattaaaatttggtctattacctttcgtggtataagttctggacaaacacaa
actgaaaactttggtttacttgaggcaattattcaaggtagtttagttgaacttgacaga
gagttctggaagttatttactggctcagcctgtaaaccttcaagtccttcagtatgctgc
ttgactttggcacttagcgtctgtgtagttccagatgcaataaaaatgggaacagaacaa
agtgtgtgtgaagcaaatagaagtttttctgtaaaggagtcaataatgaggtggctctta
ttctaccagttagaggatgacttagaagacagcacagagctgcctccaattcttcaaagt
aattttcctcatcttgtactggaaaaaattcttgtaagtctcactatgaaaaactcaaaa
gctgcaatgaagttttttcaaagtgtgccagaatgtgaacaacattgcgaagataaagag
cattcattttcagaagtagaagaactgtttcttcagactacttttgacaagatggatttt
ttaactactgtcaaagagaacgtcgtagaaaaatttcaatctagtgttggcttctctgtc
cagcaacatctcaaggaatcattggatcgctatcttctgggattatcaggacagctttta
agtaattactcttctgagattacaagttctgaaacccttgtccggtgttcaagtcttttg
gtgggtgttcttggctgctattgttacatgggcataataaccgaagacgaagcacataag
tcagaattattccagaaagccaagtctctgatgcaatgtgcaggagaaagtatctctctg
tttaaaaataaaacaaatgaagaatcaagaattggttcattgagaaatgtgatacatctg
tgtacaagttgcttgtgtatacataccaggcatacgccaaacaagattgcctctggctta
ttcctacgattattaacatcaaagcttatgaatgacattgcagatatttgtaaaagttta
gcatcctatatgaaaaagccattggattatggagaagtacatccagtgaaagatgatgat
ggtggcagtggtgatgaaagtctgatggaggcagagggtccatcatccactgatctattt
agtgcttaccccgctagtactgtgagcgatgcaaatgattatggagagaaccagaatgct
gttggtgccatgagtcctttaactgccgactacctgtccaaacaagatcatcttctttta
gacatgctcaggttcttatgcctatctgtaactgcatctcagagccatactgtgtctttt
agaggagctgacattagaagaaaattgttactgctgcttgattctagcacactggatctt
acgaaacccctccacctacatatgtacttagtgcttctgaaggatctccctggaaaagag
cattcgttgccaatggaagatgttgttgaacttctgcaaccattatcccttgtgtgttct
ctgcatcgacgtgaccaagatgtctgtaaaacaattctaagcaatgtccttcatatagtg
acaaacctaggccagggcagtgtggacatggagagcacacggattgctcaaggacacttc
ctgacagtgatgggagcattttggcatttaacaaaggaaaagaaatgtgtattctctgta
agaatggcattagtaaagtgtcttcaaacactgcttgaggctgatccatattccgaatgg
gcgattcttaatgtaaagggacaagactttcctgtaaatgaagcttttccacaatttctt
gctgatgatcatcatcaagttcggatgttggctgcagggtcaatcaacagattattccag
gatatgagacaaggcgatttctccagaagcttgaaatcacttccttcgaagtttcagcag
acatcttttaacaatgcatacatgacagcagaggcgggaatcagagcactgttatgtgat
tctcagaacccagatcttctggatgagatctataacagaaaatctgtactactgatgctg
atagctgtggtcttgcactgtagcccagtctgtgaaaaacaggctttgtttgccttatgc
aagtctgtgaagcaaaacggactagaacctcatctcgtgaaaaaggttttagagaaagtc
tctgaatcgtttggatgtagaagtttagaagacttcatggtttctcacctagactacctg
gttttggaatggctgaaccttcaagatactgaatatagtttatcttcttttccttttatg
ttattaaactacacaagtattgaggatttctatcggtcttgttacaagattttgatccca
catttggtcatcagaagccattttgatgaggtgaagtccattgctaatcagattcagaag
tgctggaaaagcctgctggtagactgctttccgaagattcttgtgcacatccttccttac
tttgcctacgagggcacgggagacagcagcgtatcacagaagagagagactgctaccaag
gtctatgatacgcttaaaggagaagacttcctaggaaaacagattgatcaagtattcatt
agtaatttgccagagattgtggtggagttgctgatgacattgcatgagacagcatcagct
gactcggatgccagtcagagtgcagtcctctgtgatttttcaggggatttggatcctgcc
cccaacccgccatatttcccatcacatgtcattaaggcaacgtttgcttacatcagcaac
tgtcataaaaccaagtttaaaagcattctagaaattctttctaaaatccctgattcctat
cagaaaatacttctggccatttgtgaacaagcagctgagacgaataatgtctttaaaaag
cacagaattcttaaaatatattatctgtttgttagtttattactgaaagatatacaaagt
ggcctgggaggagcttgggcctttgtccttcgagatgttatttatactttgattcactat
atcaataaaaggtcttctcatttcacagatgtgtcattgcgtagcttttccctttgctgt
gacctattaagtcgagtttgtcatacagctgtaactcaatgtaaagatgctctagaaaac
catcttcacgttatcgttggcacacttattccccttgtggattatcaggaagttcaagaa
caggtattggacctgttgaagtacttagtgatagataacaaagacaataaaaacctcttt
gtcacaattaagcttttggatccttttcctgaccatgttatttttaaggatttgcgtctt
actcaacagaaaatcaaatatagtggaggacctttttcactcttagaggaaataaaccat
tttctctcagtgagtgcttataatccactcccgctgaccaggcttgaaggactgaaggac
cttcgaagacaactggagcaacataaagatcagatgctagatcttctgaaagcatctcag
gataacccacaagatggcattgtagtgaagctagttgtcagcttgttgcagttatccaag
atggcagtgaaccagaccggtgaaagagaagttttagaggctgtcggaaggtgtttggga
gaaataggtcctctggatttctccaccatagctgtacagcataacagagatgcctcctat
accaaagcctacgggttacctgaagacagagaacttcagtggaccttgataatgctgacg
gccctgaacaataccctagtagaggacagtgtcaaagttcgatccgctgctgctacctgt
ttgaaaaacattttggctacaaagactggacatgttttctgggagaattataagacgtca
gcggatccaatgctggcctatctacagccttttagaacatcaaggaaaaagtttttagaa
gtgcctcgatctgttaaagaagatgttttagaaggcctggatgatgtgaatctgtgggtt
cctcaaagtgaaagtcatgacatttggataaagacactgacatgtgcctttctggacagt
ggaggcataaaaagtgaaattcttcagttattaaagccaatgtgtgaagtgaaaaccgac
ttctgtcagatggtgctgccatacttgatccatgatgttttactccaagatacacatgaa
tcgtggagaactctgctgtctacacatgtccgaggatttttcactagttgttttaagcat
tcctcccaagcaagccgctcagcaactcctgcaaattcagattcagagtcagagaacttt
ctccggtgctgcttggataaaaagtcacaaagaaccatgcttgctgttgtcgactatctg
agaaggcaaaagaggccttcctcaggaactgcttttgatgacgctttctggctggatttg
aattatcttgaggttgcgaaggtggctcagtcctgctctgctcacttcacagccttgctc
tacgcagagatctattctgataagaaaagcacagacgagcaagagaaaagaagtccaaca
tttgaagaaggaagtcaaggtacaactatttctagtttgagtgaaaaaagtaaagaagaa
actggaataagcttacaggatcttctcttagagatctacagaagtataggagagccagac
agcctgtatggctgtggaggaggaaaaatgttacaaccccttactagaatacggacatat
gaacatgaagcaacgtgggagaaggccttagtaacatacgacctggagaccagcatctcc
tcctccacccgccagtcgggaatcatccaggccctgcagaatttggggctctcccatatt
ctgtccatctatttgaaaggactagatcatgaaagaaaagagtggtgtgctgaactgcag
gagctgcattaccagacggcgtggaggaacatgcagtgggacctctgcggttctgccagc
caagaagtagaaggaaccagttaccatgaatcattgtataatgctctgcagtgtctaaga
aacagagaactctccacattttatgaaagtctccgatatgccagggtgaaagaagttgaa
gagttgagtaagggcagccttgagtctgtatattcgctgtatcccacacttagtagattg
caggcaattggagaactggaaaacagtggagagcttttttcaaggtcagtcacagacaga
gagcgctctgaagcatacttgaagtggcagaagcactcccagcttctgaaagacagtgat
ttcagctttcaggagcctctcatggctctacgcacagtcattctggagatcttggtacaa
aaggaaatggagaactctcaaggagcatgctctaaggacattctcaccaaacaccttgtt
gaattctctgttctggctcgaaccttcaagaacacacagctccctgaaagagcaatattt
aaaattaagcaatataattcagctatttgtggcatttctgagtggcatttggaagaagca
caagtattctgggcaaaaaaggagcagagtcttgctctgaatgttctcaagcaaatgatc
aagaagttggactccagctttaaagagaatgatgcagctctcaaagtcatacacgcagag
tgtctgagggtttgtggcagctggctggcagagacttgcttagaaaaccctgcagtcatc
atgcagacctatctagaaaaggcagtgaaggttgctggaagttacgatggcaacagcaga
gagctcagaaatggacagatgaaggcctttctctctttggcgcggttctctgacactcag
taccagagaattgaaaactacatgaagtcatcggaatttgaaaacaagcagactctctta
aaaagagccaaagaggaagtgggccttctaagggaacataaaattcagactaacagatac
acagtaaaggttcagagagaactggagctggatgaatgtgctctccgtgcactgaaagag
gatcgcaaacgcttcctgtgtaaggcagtcgagaactacatcaactgcttactaagcgga
gaagaacatgatctgtgggtgttccggctttgctccctctggcttgaaaattctggagtt
tctgaagtcaatggcatgatgaagaaagatggaatgaagatatcatcctataagtttttg
cctctcatgtatcaattggctgctcgaatggggaccaaaatgacaggaggcctaggattt
catgaagtcctcaataatctcatctctaggatttccctggatcacccccatcacactttg
ttcattatactggccttagcaaatgcgaacaaagatgaatttttgagcaaaccagagaca
gcaagaaggagtagaataaccaaaagtacacctaaagaaaactcgcagctcgatgaggat
cgaacagaggctgcaaccaaaatcatccactccatcagaagtaagagatgtaagatggtg
aaggacatggaggcgctctgcgatgcctacatcatattggcaaacttggatgcctctcag
tggaggactcagagaaaaggcatcaatattccagccaaccagccaatcactaaactgaag
aatttagaagatgttgttgttccaactatggaaattaaggttgaccccacaggagagtat
ggaaatctggtgactataaaatcatttaaaacagaatttcgcttagctggaggcttaaat
ttacccaaaataatagattgtgtgggttctgatggcaaggaaaggagacagcttgtgaag
ggccgtgatgacctgaggcaagatgctgtcatgcagcaggtcttccagatgtgcaataca
ctactgcagagaaacaccgagactagaaagaggaaactgactatctgcacatacaaggtg
gttcccctctctcagagaagtggtgttctcgagtggtgcacaggaaccactcctattggt
gaatatcttgttaacaacgaagaaggcgcgcataaaagatacaggccaaatgatttcagt
gcctaccagtgccaaaagaaaatgatggaagtgcaaaagaagtcttttgaagagaaatat
gataccttcatgactatttgccaaaacttcgaaccagttttccgttacttctgcatggaa
aaattcttggacccagctgtttggtttgagaaacgattggcatatacgcgtagtgtggct
acatcttctattgttggttacatccttggacttggtgacaggcacgtacagaatatcttg
ataaacgagcagtcggcagaacttgtgcacatagatctgggagtggcttttgaacagggg
aagatccttcctactccagaaacagttccttttagactcagcagagatattgtggatggg
atgggcatcaccggtgtggaaggtgtcttcagaaggtgctgtgaaaaaacaatggaagtt
atgcgtagttctcaggaaaccctgctgaccattgtagaggttcttttgtacgatccactc
tttgattggactatgaatcctttaaaagctttgtatctacagcagaggccagaagatgag
tctgacctccattccacccccaatgcagatgatcaagaatacaaacaaagtcttagtgat
actgaccagagtttcaacaaagtagctgagcgtgtcttgatgagattgcaagagaaactg
aaaggtgtggaggaaggcactgtgctcagcgtgggtggacaggtgaacttgcttatccag
caggccatggaccctaaaaacctcagccgactcttcccaggatggaaagcttgggtgtga

DBGET integrated database retrieval system