KEGG   Mus pahari (shrew mouse): 110327528
Entry
110327528         CDS       T05929                                 

Gene name
Itgam
Definition
(RefSeq) integrin alpha-M isoform X1
  KO
K06461  integrin alpha M
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04015  Rap1 signaling pathway
mpah04145  Phagosome
mpah04514  Cell adhesion molecules
mpah04610  Complement and coagulation cascades
mpah04640  Hematopoietic cell lineage
mpah04670  Leukocyte transendothelial migration
mpah04810  Regulation of actin cytoskeleton
mpah05133  Pertussis
mpah05134  Legionellosis
mpah05140  Leishmaniasis
mpah05146  Amoebiasis
mpah05150  Staphylococcus aureus infection
mpah05152  Tuberculosis
mpah05202  Transcriptional misregulation in cancer
mpah05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110327528 (Itgam)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110327528 (Itgam)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110327528 (Itgam)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110327528 (Itgam)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110327528 (Itgam)
   04610 Complement and coagulation cascades
    110327528 (Itgam)
   04670 Leukocyte transendothelial migration
    110327528 (Itgam)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110327528 (Itgam)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    110327528 (Itgam)
  09171 Infectious disease: bacterial
   05133 Pertussis
    110327528 (Itgam)
   05134 Legionellosis
    110327528 (Itgam)
   05150 Staphylococcus aureus infection
    110327528 (Itgam)
   05152 Tuberculosis
    110327528 (Itgam)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110327528 (Itgam)
   05140 Leishmaniasis
    110327528 (Itgam)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110327528 (Itgam)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110327528 (Itgam)
   04515 Cell adhesion molecules [BR:mpah04515]
    110327528 (Itgam)
   04090 CD molecules [BR:mpah04090]
    110327528 (Itgam)
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110327528 (Itgam)
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    110327528 (Itgam)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110327528 (Itgam)
Cell adhesion molecules [BR:mpah04515]
 Integrins
  Integrin alpha subunits
   110327528 (Itgam)
CD molecules [BR:mpah04090]
 Proteins
  110327528 (Itgam)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Adhesion molecules of cell surface
   110327528 (Itgam)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 Integrin_alpha VCBS FG-GAP_2
Other DBs
NCBI-GeneID: 110327528
NCBI-ProteinID: XP_021062264
Ensembl: MGP_PahariEiJ_G0013743
LinkDB
Position
1
AA seq 1152 aa
MTLKVLLVTALALCHGFNMDTEHPMTFQENARGFGQSVVQLGGTSVVVAAPQEAKAVNQT
GVLYQCDFSTSRCVPIPLHVPPEAVNMSLGLSLAATTVPPQLLACGPTVHQNCKENTYVN
GLCYLFGSNLLRPPQQYPEALRECPQQESDIVFLIDGSGSINNFEFQKMKEFVSTVMEQF
RKSKTLFSLMQYSNNFRIHFTFNDFKRNPSSRSLVNPIKQLTGSTKTASGIRKVVRELFQ
KTNGARENAVKILVVITDGDKSGDPLDYSDVIPEADRAGVIRYVIGVGNAFNKPDSRREL
DTIASKPAGEHVFHVNNFEALNTIQNQLQEKIFAIEGTQSGSTSSFEHEMSQEGFSATIT
SNGPLLGSVGSFDWAGGAFLYTSKDKATFINTTRVDSDMNDAYLGYASAVVLRNRVQSLV
LGAPRYQHIGLVVMFRENFGTWEPHTTIKGSQIGSYFGASLCSVDMDADGNTNLILIGAP
HHYEKTRGGQVSVCPLPRGRARWQCEALLHGDQGHPWGRFGAALTVLGDVNGDKLTDVAI
GAPGEQENQGAVYIFHGASITSLSASHSQRIIGSRFSPGLQYFGQSLSGGKDLTMDGLMD
LAVGAQGHLLLLRARPVLRLEATMEFSPKNIARSVFACQEQVLKNKDAGEVRVCLRVRKN
TKDRLREGDIQSTVTYDLALDPGHSRIRAFFDETKNNTRRRTQVFGLTQKCETLKLILPD
CVDNSVNPIILRLNYTLVGEPSRPFGNLRPVLAVDAQRFFTAMFPFEKNCGNDSICQDDL
SITMSAMGLDTLVVGGPPDFNVSVTLRNDGEDSYGTQVTFYYPSGLSYRKVSASQNPLSK
KPWIVKPAESSSSEGHGALKSATWNINHPIFPANSEVTFNVTFDVDSDASLGNKLLLKAI
VTSENNVSRTHKTEFQLELPVKYAIYMIVTSDESSIRYLNFTASEMTSKVIQHQYQFNNL
GQRSVPVSVVFWIPVQINNVTIWDRPQVIFSQNLSSACHTEQKSPSRSNFRDQLEKTPVL
NCSVAVCKRMQCDLPSFNTQEIFNVTLKGNLSFDWYIKTSHNHLLLVSSAEILFNDSAFA
LLPGQELYVRSKTETKVEPYEVHNPVPLIVGSSIGGLVLLALITAGLYKLGFFKRQYKDM
MSEAAPQDAPPQ
NT seq 3459 nt   +upstreamnt  +downstreamnt
atgactcttaaagttcttctggtaacagccctagctttgtgtcatggcttcaacatggac
actgaacatcccatgaccttccaagagaatgcaagaggctttggacagagtgtggtccag
cttggcggaaccagtgtggttgttgcagccccccaggaggcaaaggctgttaaccagaca
ggtgtcctctaccaatgtgacttcagcacaagccggtgtgtccccattcccctgcacgta
cctccagaggctgtgaatatgtccttgggcctgtccctggctgctactactgtccctcca
cagctgctggcctgtggccccacagtgcaccaaaactgtaaggagaacacttatgtgaat
ggattgtgctatctgtttggctccaacctgctgaggccaccccagcagtacccagaggct
ctcagagaatgtcctcagcaggagagtgacattgtcttcttgattgatggctccggtagc
atcaacaactttgaatttcagaagatgaaggagtttgtctcaactgtgatggaacagttc
agaaagtctaaaaccttgttctctttgatgcagtactcgaataatttccggattcacttc
accttcaatgacttcaagagaaaccctagctcaagatcactcgtgaacccaataaagcag
ctgactggaagtacaaaaactgcctcagggatccggaaagtagtgagagaactgtttcaa
aaaaccaatggggcccgggagaatgctgtgaagatcctagttgtcatcacagatggagac
aaatctggtgatcccttggattatagtgatgtcatccccgaggcagacagagcaggggtc
attcgctacgtaattggggtgggaaatgccttcaacaaaccagattcccgcagagagctc
gacactatcgcgtctaagccagctggtgaacacgtgttccacgtgaacaacttcgaagcc
ctgaataccattcagaaccagctccaggaaaagatctttgcaattgagggcacgcagtca
ggaagtaccagctcctttgagcacgagatgtctcaagaaggcttcagtgctaccattact
tctaatggtcccttgctgggctctgtggggagttttgactgggcaggtggagccttcctg
tatacatcaaaggataaagccaccttcatcaacacaaccagagtggattcagacatgaat
gacgcttacttgggttatgcttctgcagtcgtcttgaggaaccgtgtccaaagcttggtt
ttaggggcacctcggtatcagcatattggcctggtggtgatgttcagggagaatttcggt
acctgggagccccacactaccatcaagggcagccagattggctcttattttggggcctcc
ctttgctctgtggacatggacgctgatggcaataccaacttgatcctcatcggggccccc
catcactacgagaagacccgaggaggccaggtgtcagtgtgccccttgcctcgagggagg
gcacggtggcagtgtgaagctcttctccatggtgatcagggccatccctggggtcgcttt
ggggcagccctgacagtgctgggagatgtgaacggggacaaactgacagatgtggccatc
ggggccccaggagagcaggagaatcagggcgctgtgtacatttttcatggagcatcaata
accagcctcagtgcctcccacagccagcggatcataggctcccgcttctcccccggactt
cagtacttcgggcagtctctgagtgggggcaaggacctcacaatggacggcttgatggac
ctagctgtgggggcgcaggggcatcttctgctgctcagagcccggcccgtgctgagactg
gaggcaaccatggaattcagccccaagaatatagcaaggagtgtgtttgcatgtcaagaa
caagtattaaaaaacaaggatgctggggaggtcagagtctgcctccgtgtccgcaagaac
accaaggaccgtctgcgcgaaggagatatccagagcacggtcacttatgacctggcttta
gaccctggccactcacgtatccgtgccttctttgatgagaccaagaacaacacacgcagg
cgcacccaggtctttggattgacacagaaatgtgaaaccctgaaattaattttaccggac
tgtgtggacaactcagtgaatcccatcatcctgcgcctcaattatacactggttggggag
ccctcgcggccctttgggaaccttcgaccagttctggctgtggatgctcagaggttcttc
acagctatgtttccctttgagaaaaactgtggcaatgacagtatctgccaagacgatctc
agcatcaccatgagtgccatgggcttggacactttggtggtgggaggccccccagacttt
aacgtgagtgtgactctgagaaatgacggtgaggattcctacgggacccaagttaccttc
tactacccatctggcttgtcttaccggaaggtgtcagcaagccagaacccgctctccaag
aagccgtggattgtgaagcctgctgagtccagctcttctgaagggcatggggctctgaag
agcgccacctggaatataaaccatcccatctttcctgctaattctgaggtcacatttaat
gtcacattcgatgtggactctgatgcctcccttgggaacaaactgctcctcaaggccatt
gtgaccagtgagaacaacgtgtccaggacccacaaaactgagtttcagttggagctgcct
gtgaagtacgccatctacatgattgtcaccagcgatgagagttctatcagatatctcaac
ttcacagcttcagagatgaccagtaaggtcatacagcatcagtaccagttcaacaacctg
ggccagaggagcgtccctgtcagtgtggtcttctggatccctgtccagatcaacaatgtg
accatatgggatcgtccccaggtcatcttctcccagaacctctcaagtgcctgtcacact
gagcagaaatccccctctcgctccaatttccgggatcagcttgaaaagaccccagtgctg
aactgctctgttgcagtctgtaagcgaatgcagtgtgacctcccatccttcaacactcag
gaaatattcaatgttaccctcaagggcaacctatcatttgactggtacatcaagacttct
cataaccacctcttgcttgtgagcagcgctgagatcctgtttaatgactctgcgtttgcc
ctgcttccagggcaggagttgtatgtgaggtctaagacagagaccaaagtggagccatat
gaagttcacaaccctgtaccactcattgtgggcagctccattgggggcctggtactcttg
gctctcatcactgctggcctatacaagcttggctttttcaagcggcagtacaaggacatg
atgagtgaagctgccccccaagatgctccacctcagtaa

DBGET integrated database retrieval system