KEGG   Mus pahari (shrew mouse): 110327714
Entry
110327714         CDS       T05929                                 

Gene name
Rassf1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04014  Ras signaling pathway
mpah04390  Hippo signaling pathway
mpah04392  Hippo signaling pathway - multiple species
mpah05200  Pathways in cancer
mpah05206  MicroRNAs in cancer
mpah05219  Bladder cancer
mpah05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    110327714 (Rassf1)
   04390 Hippo signaling pathway
    110327714 (Rassf1)
   04392 Hippo signaling pathway - multiple species
    110327714 (Rassf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110327714 (Rassf1)
   05206 MicroRNAs in cancer
    110327714 (Rassf1)
  09162 Cancer: specific types
   05219 Bladder cancer
    110327714 (Rassf1)
   05223 Non-small cell lung cancer
    110327714 (Rassf1)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Mst1_SARAH
Other DBs
NCBI-GeneID: 110327714
NCBI-ProteinID: XP_021062527
Ensembl: MGP_PahariEiJ_G0015516
LinkDB
Position
10
AA seq 340 aa
MSAEPELIELRELTPSGRIGPGRTRLERANALRIAPGTTRNPSQQHVPGRGHRFQPAGPT
THTWCDLCGDFIWGVVRKGLQCAHCKFTCHYRCRALVCLDCCGPRDLGWDSALERDTNVD
EAVERETPDLSQAETEQKIKDYNGQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSK
KPPSLQDARRGTGRSTAVRRRTSFYLPKDAIKHLHVLSRTRAREVIEALLRKFMVVDDPR
KFALFERTERHGQVYLRKLSDDEQPLKLRLLAGPSEKALSFVLKENDSGEVNWDAFSMPE
LHNFLRILQREEEEHLRQILQKYSRCRQKIQEALHACPLG
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgtcggcggagccagaactcattgaactacgcgagctgacaccgtccgggcgcatcggt
ccaggccgtacccggctggagcgtgccaacgctctgcgcatcgccccgggtacaacacgc
aatccgtcacagcagcacgtcccgggtcgtggccaccgcttccagcctgcagggcccacc
acgcacacgtggtgcgacctctgtggagacttcatctggggcgtcgtgcgcaagggccta
cagtgcgcgcactgcaagttcacctgccattaccgttgtcgtgcgctcgtctgcttggac
tgctgcgggccccgagacctgggctgggactctgcactagagcgggacacgaacgtggat
gaggctgtggagcgggagacacctgatctttctcaagctgagacagagcagaaaatcaag
gattacaatggccagatcaacagcaacctcttcatgagcctgaataaggatggctcctac
acaggcttcatcaaggttcagctgaaactagtacgccctgtttcagtgccttccagcaag
aaaccaccttccttacaggatgcccggagaggcacggggcggagcacagcggtgaggcgc
cgcacttctttttacttgcctaaggatgctattaagcatctgcatgttctatcacgaaca
cgggcacgtgaggtcattgaggccctgcttcgaaaattcatggtagtagatgatcctcgc
aagtttgcactctttgagcgaactgaacgtcatggccaagtatacctccggaaactgtcg
gatgatgagcagcccttgaagctgcggcttcttgcagggcccagtgaaaaagccctgagc
tttgtcctgaaggagaatgactcaggagaggtgaattgggatgccttcagcatgcctgaa
ctgcacaatttcctacgcatcctgcagcgggaagaagaggaacaccttcgccagatcctg
cagaagtattctcgttgtcgccagaagatccaggaggccctgcacgcctgtcctttgggg
tga

DBGET integrated database retrieval system