KEGG   Mus pahari (shrew mouse): 110327725
Entry
110327725         CDS       T05929                                 

Gene name
Zbtb16
Definition
(RefSeq) zinc finger and BTB domain-containing protein 16 isoform X1
  KO
K10055  zinc finger and BTB domain-containing protein 16
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110327725 (Zbtb16)
   05202 Transcriptional misregulation in cancer
    110327725 (Zbtb16)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    110327725 (Zbtb16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110327725 (Zbtb16)
   04121 Ubiquitin system [BR:mpah04121]
    110327725 (Zbtb16)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    110327725 (Zbtb16)
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     110327725 (Zbtb16)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2_4 zf-C2H2 BTB zf-C2H2_6 zf-met zf-C2H2_jaz zf_UBZ zf-C2H2_2 Endonuclease_7 zinc_ribbon_15
Other DBs
NCBI-GeneID: 110327725
NCBI-ProteinID: XP_021062560
Ensembl: MGP_PahariEiJ_G0015038
LinkDB
Position
10
AA seq 673 aa
MDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFE
ILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLK
ILETIQASDDNDTEATMADGGGEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPM
VDQSPSVSTSFGLSAMSPTKAAVDSLMSIGQSLLQGTLQPPAGPEEPTLAGGGRHPGVAE
VKMEMMQVDEAPGQDSPGTAESSISGGMGDKLEERSKEGPGTPTRGSVITSARELHYGRE
ESGEQLSPPVEAGQGPPGRQEPLAPPVEKHLGIYSVLPNHKADAVLSMPSSVTSGLHVQP
ALAVSMDFSTYGGLLPQGFIQRELFSKLGELAVGMKAESRPLGEQCSVCGVELPDNEAVE
QHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHR
QTHTGTDMAVFCLLCGKRFQAQSALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSH
TGDHPYECEFCGSCFRDESTLKSHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEK
PFECKLCHQRSRDYSAMIKHLRTHNGASPYQCTICTEYCPSLSSMQKHMKSHKPEEIPPD
WRIEKTYLYLCYV
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggatctgacaaagatggggatgatccagcttcagaaccctagccaccccacggggctg
ctgtgcaaggccaatcagatgcgactggccgggactttgtgtgatgtggtcatcatggtg
gacagccaggagttccatgcccaccggacggtgctagcctgcaccagcaagatgtttgag
atcctcttccaccgaaacagccagcactatactctggacttcctctcaccaaaaaccttc
cagcagatcctggagtacgcctacacggccacgctgcaagccaaggcagaggacctggat
gacctgctgtacgcagcggagattctggagatcgagtacctggaggagcagtgcctgaag
atcctggagaccatccaggcgtccgacgacaatgacacagaggccaccatggctgacggt
gggggcgaagaagaagaggaccgtaaggctcgatacctcaagaacatctttatctcgaag
cattccagcgaggagagtggctacgccagtgtggctggacagagcctccctgggcccatg
gtggaccagagcccctcggtctccacctcttttggtctctcagccatgagtcctaccaag
gcagcggtggacagcttgatgagtatagggcagtcactcctgcaaggaactcttcagcca
cctgcagggcccgaggagcccacactggcagggggtgggcggcaccctggggtggctgag
gtgaagatggaaatgatgcaggtagatgaagcccctggccaggacagccctgggaccgct
gagtctagcatctcaggagggatgggggacaagcttgaagagaggagcaaagaggggcct
gggaccccgactcgaggcagcgtcatcaccagtgccagagagctgcattatgggagagag
gagagtggtgagcagctctcgcctcctgttgaagctggccagggaccccctgggcggcag
gagcccctggcacccccagtggagaagcatttgggcatctactcggtgctgcccaaccac
aaggccgatgctgtgttgagcatgccgtcttcagtgacatctggtctccatgtgcaacct
gccctggcagtctccatggacttcagcacctatgggggtctgctgcctcagggcttcatc
cagagggagctgttcagcaagctgggtgagctggctgtgggcatgaaggctgagagccgt
cctctgggggagcagtgcagcgtgtgtggggtcgagcttccagacaacgaggccgtggaa
cagcacaggaaactgcacagtgggatgaagacatacgggtgtgaactctgtggaaaacgg
ttcctggacagtttgcgactgagaatgcatttactggctcattcagcgggtgccaaagcc
tttgtgtgtgatcagtgtggtgcccagttctcgaaggaggatgccctggagacacacaga
cagacccatactggcacggacatggctgtcttctgtctgctgtgtgggaagcgttttcag
gcacaaagcgcactccagcagcacatggaggtccacgcaggcgtgcgcagctatatctgc
agtgagtgcaaccgcaccttccccagccacacggctctcaagcgccaccttcgctcacat
acaggtgaccacccatatgagtgtgagttttgcggcagctgcttccgggatgagagcaca
ctcaagagccacaagcgcatccacacaggggagaagccctatgagtgtaacggctgtggc
aagaaattcagcctcaagcaccagttggagacgcactacagggttcacacaggtgagaag
ccctttgagtgcaaactctgccaccagcgctcccgggactactcggccatgatcaagcac
ctgagaacacacaacggtgcctcgccataccagtgtaccatctgcacggaatactgcccc
agcctctcctccatgcagaaacacatgaagagccacaagccggaggagatcccacctgac
tggaggatagagaagacgtacctctacctgtgttatgtgtga

KEGG   Mus pahari (shrew mouse): 110331544
Entry
110331544         CDS       T05929                                 

Gene name
Rara
Definition
(RefSeq) retinoic acid receptor alpha isoform X1
  KO
K08527  retinoic acid receptor alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04659  Th17 cell differentiation
mpah04915  Estrogen signaling pathway
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    110331544 (Rara)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    110331544 (Rara)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110331544 (Rara)
   05202 Transcriptional misregulation in cancer
    110331544 (Rara)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    110331544 (Rara)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110331544 (Rara)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mpah03310]
    110331544 (Rara)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    110331544 (Rara)
Nuclear receptors [BR:mpah03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   110331544 (Rara)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 110331544
NCBI-ProteinID: XP_021067902
Ensembl: MGP_PahariEiJ_G0018232
LinkDB
Position
14
AA seq 462 aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTSLQHQLPVSGYSTPSPAT
IETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
VYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEAPKPECSESYTL
TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTV
EFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDKVDMLQEPLLEALK
VYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL
DTLSGQSGGGTRDGGGLAPPPGSCSPSLSPSSHRSSPATQSP
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggccagcaatagcagttcctgcccaacacctgggggcgggcacctcaatgggtaccca
gtacccccctacgccttcttcttcccccctatgctgggtggactctccccgcccggcgct
ctcaccagcctccagcaccagcttccagtcagtggttacagcacaccgtccccagccacc
atcgagacccagagcagcagttccgaagagatagtgcccagccctccctcgccgccaccc
ctgccccgcatctacaagccctgctttgtttgtcaagacaagtcatccggctaccactat
ggggtcagcgcctgtgagggctgtaagggcttcttccgacgcagcatccagaagaacatg
gtgtatacgtgtcaccgggacaagaactgcatcatcaacaaggtgacccggaaccgctgc
cagtactgccggctgcagaaatgcttcgaagtgggcatgtccaaggagtcggtgcgaaat
gatcgaaacaaaaagaagaaagaggcacccaagcccgagtgctcggagagctacacgctg
acgccggaggtgggggagctcatcgagaaggtccgcaaagcgcaccaggagacctttccg
gccctctgccagctgggcaagtacactacgaacaacagctcagaacaacgcgtctccctg
gacattgacctctgggacaagttcagtgaactctccaccaagtgtatcattaagactgtg
gagttcgccaagcagcttcccggcttcaccaccctcaccatcgccgaccagatcaccctc
ctcaaggctgcctgcctggatatcctgattctgcgaatctgcacgcggtacacgcctgag
caagacacaatgaccttctcagatggactgaccctgaaccggactcagatgcacaacgct
ggctttggccccctcaccgacttggtctttgcctttgccaaccagctgctgcccctggag
atggacgacgctgagactggactgctcagtgccatctgccttatctgtggagaccgccag
gacctggagcagccagacaaggtggacatgctgcaggagccgctgctggaagcactgaaa
gtctacgtccggaaacggaggcccagccgaccccacatgttccccaagatgctgatgaag
atcacagaccttcggagcatcagcgccaagggagctgaacgggtgatcacactgaagatg
gagatccctggttccatgccacccctgatccaggagatgctggagaactctgagggcttg
gacactctaagcggacagtcagggggcggaacgcgagatgggggtggcctggccccacct
ccgggtagctgtagccccagcctcagtcccagctcccacagaagcagcccagccactcag
tccccatga

DBGET integrated database retrieval system