KEGG   Mus pahari (shrew mouse): 110327918
Entry
110327918         CDS       T05929                                 

Gene name
Cish
Definition
(RefSeq) cytokine-inducible SH2-containing protein isoform X1
  KO
K04701  cytokine inducible SH2-containing protein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04630  JAK-STAT signaling pathway
mpah04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110327918 (Cish)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    110327918 (Cish)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110327918 (Cish)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mpah04990]
    110327918 (Cish)
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     110327918 (Cish)
Domain-containing proteins not elsewhere classified [BR:mpah04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   110327918 (Cish)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 110327918
NCBI-ProteinID: XP_021062859
Ensembl: MGP_PahariEiJ_G0015508
LinkDB
Position
10
AA seq 257 aa
MVLCVQGSCPLLAVEQIGRRPLWAQSLELPGPAMQPLPTGAFPEEVTEETPVQAENEPKV
LDPEGDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSV
KTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCAADSRSDSPDPAP
TPALPMPKQDAPSDSVLSMPVATAVHLKLVQPFVRRSSARSLQHLCRLVINRLVADVDCL
PLPRRMADYLRQYPFQL
NT seq 774 nt   +upstreamnt  +downstreamnt
atggtcctctgcgtacagggatcttgtcctttgctggctgtggagcaaattgggcggcgg
cctctgtgggcccagtccctggagctgcccgggccagccatgcagcccttacccactggg
gcattcccagaggaagtgacagaggagacccctgtccaggcagagaatgaaccgaaggtg
ctagaccctgagggggatctgctgtgcatagccaagacgttctcctaccttcgggaatct
gggtggtattggggttccattacagccagcgaggcccggcagcacctacagaagatgccg
gagggtacattcctcgttcgagacagcacccaccccagctacctgttcacgctgtcagtc
aaaaccacccgtggccccaccaacgtacggatcgagtatgccgattctagcttccggctg
gactccaactgcttgtcaagacctcgaatcctggccttcccagatgtggtcagccttgtg
cagcactatgtggcctcctgtgcggctgacagccggagcgacagcccggatcctgctccc
acccccgccctgcctatgcctaagcaagatgcacctagtgactcggtgctgtctatgcct
gtggctactgcggtgcacctgaaactggtgcagccctttgtgcgcaggagcagtgcccgc
agcttacaacatctgtgtcggctagtcatcaaccgtctggtggccgatgtggactgccta
cccctgccccggcgcatggccgactacctccgacagtaccccttccaactctga

DBGET integrated database retrieval system