KEGG   Mus pahari (shrew mouse): 110327943
Entry
110327943         CDS       T05929                                 

Gene name
Pml
Definition
(RefSeq) protein PML
  KO
K10054  probable transcription factor PML
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04120  Ubiquitin mediated proteolysis
mpah04144  Endocytosis
mpah05164  Influenza A
mpah05168  Herpes simplex virus 1 infection
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110327943 (Pml)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110327943 (Pml)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110327943 (Pml)
   05202 Transcriptional misregulation in cancer
    110327943 (Pml)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    110327943 (Pml)
  09172 Infectious disease: viral
   05164 Influenza A
    110327943 (Pml)
   05168 Herpes simplex virus 1 infection
    110327943 (Pml)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110327943 (Pml)
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    110327943 (Pml)
SSDB
Motif
Pfam: DUF3583 zf-B_box zf-C3HC4_3 BMFP Prok-RING_4 zf-RING_UBOX OmpH
Other DBs
NCBI-GeneID: 110327943
NCBI-ProteinID: XP_021062897
Ensembl: MGP_PahariEiJ_G0015156
LinkDB
Position
10
AA seq 882 aa
MQKAPAPPGSPCGQQESAPTPTPTMPPPEEPSEDYEHSQSPAEQAIKEEFQFLRCPGCQA
QAKCPKLLPCLHTLCSGCLQAPSLQCPICKAPGSADANGEALDNVFFESLQRRLAVFRQI
VDAQAACTRCKELADFWCFECEQLMCGKCFDAHQWFVKHEARSLAELRDNSVSDFLDSTR
KSNIFCSNTNHRNPAQTDIYCRGCAKPLCCTCALLDRNHSHLQCDIGEEIQQRHEELGAM
TQALEEQGTTFDSAHAQMRSALGQLDHARADIETQIRARVRQVVDYVQAQERELLEAVNE
RYQRDYQEIAGQLSCLEAVLQRIRTSGALVKRMKLYASDQEVLDMHSFLHKALCNLRQEE
PQNQKVQGLTSGFEEFKLCLQDLISCITQRTSKDAAVGTRASPEAASRLEPSTDLEQPKE
VQRVQAQALELCKTQPVAIIKTVPGAHPVPVYAFSMQGPTYKEEASQTVGPVKRKYSHED
CSRKSIKMESTEKNEDGLTTSSPEQPRPSTSKATSPPHLDGTSSPESTVPEKETLPPNNN
HVTNDTGDTEERVVVISSSEDSDTENLSSHELDGSSSESSGLQLEGPNSLKALDESLAEP
SLEDRTLVFFDLKIDNETQRISQLAAVNRESKFRVLIQPEAFSAYSKAISLEAGLQHFLS
FLRSMHRPILACPKLWGPGLPIFFQALSDINKLWEFQDAISGFLAVLPLIQERIPGASSF
KLKNLTKTYLARNMSERSALASVLAMRDLCCLLEVSPGLLLVQHIYSFSNLQCFASLQPL
IQASVLPQPEARLLALHNVSFVELLNAYRTNRQEGLKKYVRYLSLQTTPSSSSLSSASTQ
VAQFVQAVSTYMEGLLEGHAPAGAEGNATVLSDRAESKGCLA
NT seq 2649 nt   +upstreamnt  +downstreamnt
atgcagaaggcgcctgcaccccctggatctccctgtggacaacaggaatctgccccgacc
cccacgcccaccatgcctcccccagaggaaccctccgaagactatgaacacagccaaagc
cctgcagagcaagccataaaggaggaatttcagtttctgcgctgccccggctgccaggcc
caagccaagtgccccaaactgctgccttgtctgcacacgctgtgctccggatgcctccag
gcgcctagcctgcagtgccccatctgcaaggcgcctgggtcggccgatgctaatggggag
gccctggataacgtgttcttcgagagcctgcagcggcgcctggcggtgttccggcagatc
gtggatgcgcaggctgcatgtacccgctgcaaagaattggccgacttctggtgtttcgag
tgtgaacagctcatgtgcggcaagtgcttcgatgcacatcagtggtttgtcaagcatgag
gcccggtccctggccgagctccgcgacaattcagtgagcgacttcctcgacagtacgcgc
aaatccaacatcttctgctccaataccaaccaccgcaaccctgcgcagactgacatctac
tgccgaggctgcgccaagcctctgtgttgcacatgcgcgctcctggaccgcaaccacagc
catcttcagtgcgatattggtgaggagattcagcagcgccatgaggagctaggcgccatg
acacaggctctggaggagcagggcacaaccttcgacagtgcccatgcacagatgcgctca
gccttaggccagctggaccacgcacgcgcagacattgagacgcagatccgtgcacgcgtg
cgccaagtggtagactatgtgcaggctcaagagcgcgagctgctcgaggcggtgaatgaa
cgctaccagcgcgactaccaggaaatagctggccagctgagctgcctggaagctgtgctg
caacgcatccgcactagtggggcgctggtcaagaggatgaagctctacgcctccgaccag
gaggtgctggatatgcacagctttctacacaaggcactctgcaatttgcgccaggaggag
ccccagaaccagaaagtccaggggctcaccagcggcttcgaggagttcaagttgtgcctg
caggacctcatctcctgcatcacccagaggacaagtaaggatgcggctgtaggtacgaga
gccagcccagaggcagccagcaggcttgagccctcgactgaccttgagcagcccaaagaa
gtgcagagggtacaggctcaggccctagagctgtgtaagacccaacctgtggctataata
aagacagttcctggagcccaccctgtaccagtgtatgccttctctatgcaaggtcccacc
tacaaagaggaggcttctcagacagtcggccccgtgaagaggaagtactcccacgaagat
tgctccaggaagagcatcaagatggagtccacagagaagaatgaggacgggttgaccaca
agctcccccgagcagcccaggcccagcacttccaaggccacctcacctcctcatctggat
gggacttctagccctgagagcaccgtccctgaaaaagagaccctcccgcccaacaacaat
catgttaccaacgacacaggggatacagaggagcgagtcgtggtgatcagcagttcagag
gactcggacaccgagaatctgtcctcccacgagctggacggtagcagcagtgagtccagt
ggcctgcagctggagggccccaattccctcaaggccttggatgagagcctcgccgaaccc
agcttagaagacaggaccctggttttctttgacctcaagattgacaatgaaacccagaga
attagccagctggcagccgtgaaccgggaaagcaagttccgtgtgctcatccagcccgag
gccttcagtgcctactccaaggccatctccctggaagcggggctgcagcacttcctcagc
ttcctccgctccatgcaccgtcccatcttggcgtgtcctaagctgtgggggcccggactc
cccatcttcttccaggccctgagtgatattaacaagctgtgggaattccaggacgccatc
tcaggtttcttggccgtgctgcccctcatccaggaacgcatacccggcgccagcagcttc
aaacttaagaacctaaccaagacctacctggcgagaaacatgagcgaacgcagcgccctg
gcttctgtgctggccatgagggacctgtgctgcctccttgaggtctccccaggactgctg
ctggtccagcatatctactccttcagtaacttgcagtgttttgcctccctgcagccccta
attcaggctagtgtcctgccgcagcccgaggcccgcctcttggccctccacaatgtgagc
tttgtagagctgctgaacgcataccgcaccaacaggcaagaaggcttgaagaagtatgtc
cgctatctgagcctgcagaccaccccgtcgtcgtcatcattatcatcggcttccacccaa
gttgcccaattcgtgcaggctgtgagcacctacatggaaggactgttggaaggccatgcc
cctgctggggcagaaggcaatgctactgttctctctgacagagctgaaagtaagggatgc
ctggcctag

KEGG   Mus pahari (shrew mouse): 110331544
Entry
110331544         CDS       T05929                                 

Gene name
Rara
Definition
(RefSeq) retinoic acid receptor alpha isoform X1
  KO
K08527  retinoic acid receptor alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04659  Th17 cell differentiation
mpah04915  Estrogen signaling pathway
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    110331544 (Rara)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    110331544 (Rara)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110331544 (Rara)
   05202 Transcriptional misregulation in cancer
    110331544 (Rara)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    110331544 (Rara)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110331544 (Rara)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mpah03310]
    110331544 (Rara)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    110331544 (Rara)
Nuclear receptors [BR:mpah03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   110331544 (Rara)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 110331544
NCBI-ProteinID: XP_021067902
Ensembl: MGP_PahariEiJ_G0018232
LinkDB
Position
14
AA seq 462 aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTSLQHQLPVSGYSTPSPAT
IETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
VYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEAPKPECSESYTL
TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTV
EFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDKVDMLQEPLLEALK
VYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL
DTLSGQSGGGTRDGGGLAPPPGSCSPSLSPSSHRSSPATQSP
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggccagcaatagcagttcctgcccaacacctgggggcgggcacctcaatgggtaccca
gtacccccctacgccttcttcttcccccctatgctgggtggactctccccgcccggcgct
ctcaccagcctccagcaccagcttccagtcagtggttacagcacaccgtccccagccacc
atcgagacccagagcagcagttccgaagagatagtgcccagccctccctcgccgccaccc
ctgccccgcatctacaagccctgctttgtttgtcaagacaagtcatccggctaccactat
ggggtcagcgcctgtgagggctgtaagggcttcttccgacgcagcatccagaagaacatg
gtgtatacgtgtcaccgggacaagaactgcatcatcaacaaggtgacccggaaccgctgc
cagtactgccggctgcagaaatgcttcgaagtgggcatgtccaaggagtcggtgcgaaat
gatcgaaacaaaaagaagaaagaggcacccaagcccgagtgctcggagagctacacgctg
acgccggaggtgggggagctcatcgagaaggtccgcaaagcgcaccaggagacctttccg
gccctctgccagctgggcaagtacactacgaacaacagctcagaacaacgcgtctccctg
gacattgacctctgggacaagttcagtgaactctccaccaagtgtatcattaagactgtg
gagttcgccaagcagcttcccggcttcaccaccctcaccatcgccgaccagatcaccctc
ctcaaggctgcctgcctggatatcctgattctgcgaatctgcacgcggtacacgcctgag
caagacacaatgaccttctcagatggactgaccctgaaccggactcagatgcacaacgct
ggctttggccccctcaccgacttggtctttgcctttgccaaccagctgctgcccctggag
atggacgacgctgagactggactgctcagtgccatctgccttatctgtggagaccgccag
gacctggagcagccagacaaggtggacatgctgcaggagccgctgctggaagcactgaaa
gtctacgtccggaaacggaggcccagccgaccccacatgttccccaagatgctgatgaag
atcacagaccttcggagcatcagcgccaagggagctgaacgggtgatcacactgaagatg
gagatccctggttccatgccacccctgatccaggagatgctggagaactctgagggcttg
gacactctaagcggacagtcagggggcggaacgcgagatgggggtggcctggccccacct
ccgggtagctgtagccccagcctcagtcccagctcccacagaagcagcccagccactcag
tccccatga

DBGET integrated database retrieval system