Mus pahari (shrew mouse): 110328748 Help Entry 110328748         CDS       T05929                                  Name (RefSeq) histone H2B subacrosomal variant   KO K11252   histone H2B Organism mpah  Mus pahari (shrew mouse) Pathway mpah04613   Neutrophil extracellular trap formation mpah05034   Alcoholism mpah05203   Viral carcinogenesis mpah05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mpah00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     110328748  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     110328748   09163 Immune disease    05322 Systemic lupus erythematosus     110328748   09165 Substance dependence    05034 Alcoholism     110328748  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mpah03036]     110328748   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mpah04147]     110328748 Chromosome and associated proteins [BR:mpah03036]  Eukaryotic type   Nucleosome assembly factors    Histones     110328748 Exosome [BR:mpah04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110328748 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF AAA_lid_2 TFIID_20kDa Motif Other DBs NCBI-GeneID:  110328748 NCBI-ProteinID:  XP_021063838 Ensembl:  MGP_PahariEiJ_G0015902 LinkDB All DBs Position 11:complement(30095881..30096341) Genome browser AA seq 123 aa AA seqDB search MAKPTFKRHLYIKRHLRRLYRNHSRCSSINLGHGNYSLYINRVLKEVDPNRGISSHSVDI MNILINDIFERIATEAGQRMLLRKRCTLTPEDIQQAVYLLLPKKLATLAVTFGSKAVHRF IHS NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atggccaagcccaccttcaaaagacacctctacatcaaaagacatctaagacggttgtat agaaaccactcacgttgctctagcatcaatttgggccatggaaattactccctttacata aacagagtcctgaaggaagttgaccccaacagaggtatatcatctcattctgtggacatc atgaacatcctcatcaatgacatcttcgaacgcattgctacggaagccggccagcggatg ctcctcagaaagcgctgtaccctcaccccagaagatatccagcaggcagtgtatctgctg ctgccgaagaagctggctacgcttgccgtgacctttggaagtaaagccgtccacagattc atccattcttaa

DBGET integrated database retrieval system