KEGG   Mus pahari (shrew mouse): 110328966
Entry
110328966         CDS       T05929                                 

Gene name
Nkd2
Definition
(RefSeq) protein naked cuticle homolog 2 isoform X1
  KO
K03213  naked cuticle
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04310  Wnt signaling pathway
mpah04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110328966 (Nkd2)
   04390 Hippo signaling pathway
    110328966 (Nkd2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mpah04990]
    110328966 (Nkd2)
Domain-containing proteins not elsewhere classified [BR:mpah04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   110328966 (Nkd2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6
Other DBs
NCBI-GeneID: 110328966
NCBI-ProteinID: XP_021064129
Ensembl: MGP_PahariEiJ_G0015790
LinkDB
Position
11
AA seq 461 aa
MGKFQSKHAAAACKRRESPEGDSFVVSAYGSGRKGAEETDRRAGSGVEHCARDKQELLNG
DPKEGSFWEDKGSLEVVLPPEKSEGHEGQGQIFSTDDGEKAASREGPPRLSKKHLNIDAL
QCDVSVEEDNRQEWTFTLYDFDNSGKVTREDMSSLMHTIYEVVDASVNHSSGSSKTLRVK
LTVSPEPSSKKEYPLTGQDREPTRGRTEIELTDDPRVADRRLSAYSRKPNADPQPCSVRV
PYCVDENTERRNHYLDLAGIENYTSKFGPGSPPEQVRQEHHGRATHIPSRSRSQESDAHA
IHHRRSQVLAEHVIPANEPATRALAAQPRLKGQEKQFLRSPKGPGKPLGAPGSSKPGKAL
SYCLQAVPLPQGAQDGHHLPQPPPQPPPQPYGHKRYRQKAREGHSPLKGHGQPTMVEHEV
VRDLPPMLGPEGYVVPVIQRHEHHHHHEHHHHHHHHHFHPS
NT seq 1386 nt   +upstreamnt  +downstreamnt
atggggaaatttcagtccaagcacgccgcagcagcctgcaagaggagagagagtcccgaa
ggggacagcttcgtggtgtctgcgtacgggagcggtcgcaaaggagcggaagagaccgac
cggcgtgcgggcagcggtgtggaacattgcgcacgggacaagcaggagctgctcaatgga
gaccctaaggaggggtctttctgggaagacaagggttccctagaagttgtgctgccccct
gagaagtctgagggccatgaaggtcagggccagatcttcagcacagatgatggggagaag
gcagcaagccgtgagggtccaccaagacttagcaagaagcacttgaacattgacgcactg
cagtgtgacgtctcagtggaagaagacaaccgccaagaatggacattcacgttgtatgac
tttgacaacagtgggaaagtcaccagagaggacatgtccagcctgatgcacaccatctat
gaggttgtcgacgcctctgtcaatcactcctcgggcagcagcaagaccctccgagtgaaa
ctaactgtcagccctgaaccctccagcaagaaggaatatcctctcactggccaagaccgg
gagcccactcgtggcagaacagagatcgagctcacagatgacccccgagtggctgacaga
aggctatccgcctacagcaggaagcccaatgctgatccccagccatgctctgtgcgagtg
ccctactgtgtggatgagaatacagagcgcagaaaccactacctagaccttgctggcatc
gagaactatacatctaagtttggtcccgggtcaccacctgagcaggtcaggcaagaacat
catggcagggccacacacattccaagcaggtcccgatcacaggagtcggatgcccacgct
atacaccaccgcaggtctcaagtcctggctgagcatgtcataccagctaatgagcctgcc
acccgggccctggctgcacagccccggctcaaggggcaggagaagcagttcctcaggtct
cctaagggtccgggtaaacctcttggggcaccaggcagcagcaagccagggaaagctctc
agctattgcctgcaggctgtgccactgccccagggtgctcaggacggccaccaccttcct
cagcccccaccacagcctccgccgcagccctatggtcacaagcggtatcggcagaaagcc
agagaaggccactcaccactcaaggggcatggccagcctaccatggtggagcatgaagtg
gttcgggacctgcctcccatgctggggcctgagggctacgtggtgcctgtgatccagagg
catgaacaccaccatcaccatgagcaccaccaccatcaccaccaccaccacttccaccca
tcctag

KEGG   Mus pahari (shrew mouse): 110337316
Entry
110337316         CDS       T05929                                 

Gene name
Nkd1
Definition
(RefSeq) protein naked cuticle homolog 1 isoform X1
  KO
K03213  naked cuticle
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04310  Wnt signaling pathway
mpah04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110337316 (Nkd1)
   04390 Hippo signaling pathway
    110337316 (Nkd1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mpah04990]
    110337316 (Nkd1)
Domain-containing proteins not elsewhere classified [BR:mpah04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   110337316 (Nkd1)
SSDB
Motif
Pfam: EF-hand_6 EF-hand_7 EF-hand_1
Other DBs
NCBI-GeneID: 110337316
NCBI-ProteinID: XP_021075829
Ensembl: MGP_PahariEiJ_G0022957
LinkDB
Position
20
AA seq 471 aa
MGKLHSKPAAVCKRRESPEGDSFAVSAAWARKGIEEWIGRQRCPGSVSGPRQLRLAGTVG
RGTRELVGDTSREALGEEDEDDFPLEVALPPEKIDSLGSGDEKRMERLSEPGQASKKQLK
FEELQCDVSVEEDSRQEWTFTLYDFDNNGKVTREDITSLLHTIYEVVDSSVNHSPTSSKT
LRVKLTVAPDGSQSKRSVLFNHTDLQSTRPRADTKPAEELRGWEKKQRAPLRFQGDNHLE
QPDCYHHCVDENIERRNHYLDLAGIENYTSQFGPGSPSVAQKSELPPRISNPTRSRSHEP
EAAHIPHRRPQGVDPGSFHLLDTPFAKASELQQRLRGTQDGSKHFVRSPKAQGKNMGMGH
GARGARSKPPLVPTTHTVSPSAHLATGPALLPTLAPLGHKKHKHRAKESQASCRGLQAPL
AAGGSTVMGREQVRELPAVVVYESQAGQAVQRHEHHHHHEHHHHYHHFYQP
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggggaaacttcactcgaagccggccgccgtgtgcaagcgcagggagagcccggaaggt
gacagctttgccgtaagcgctgcttgggcaaggaaaggcatcgaggagtggatcgggagg
cagcgctgtccaggcagcgtctcaggaccccgtcagctgagattggcaggcactgttggt
cgaggcactcgggaactcgtgggtgacacttctagagaggctctcggtgaggaggacgag
gacgacttccccctagaagtggccctaccgcctgagaagatcgacagcttaggtagcgga
gatgagaagagaatggagagactgagcgagcccggccaggcctccaagaagcagctcaag
tttgaagagctgcagtgtgatgtctctgtggaggaggacagcaggcaagagtggactttc
actctgtatgacttcgacaacaatggcaaagtcacccgtgaggacattaccagcttgctg
cacaccatctatgaagtggttgactcctctgtgaaccattcccccacatcaagcaagaca
ctgcgggtgaagctcaccgtggcccctgacgggagccagagtaagaggagcgtccttttc
aaccataccgatctgcagagcacaaggccccgagcagacaccaaacccgctgaggagctg
cgtggctgggagaagaagcagcgagccccgctcaggttccagggtgacaaccacctggag
cagccagactgctaccaccattgcgtggatgagaacatcgagaggagaaaccactaccta
gacctggcggggatagagaactacacgtctcagtttggaccgggctccccttcggtggcc
cagaagtcagagctgccccctcgaatctccaaccctacccgctctcgctcccacgagcca
gaagccgcccacatcccacaccggaggccccaaggggtggacccgggctccttccacctc
cttgacaccccatttgccaaggcatcagagctccagcaacggctccggggtactcaggat
gggagcaagcactttgtgaggtcccccaaggcccagggcaagaacatgggtatgggccac
ggggccagaggtgcaagaagcaagcccccgctggtacccaccacccacactgtctccccc
tctgcccacctggccaccggcccagccctcctccccaccctggcacccctggggcacaag
aagcacaagcatcgagccaaggagagccaggcgagctgccggggcctgcaggcccccctg
gctgcaggaggctccaccgtcatggggcgggagcaggtgagggagctgcctgccgtggtg
gtgtacgagagccaggctgggcaggccgtccagagacacgagcaccatcaccaccacgaa
caccaccaccattaccaccacttctatcagccctag

DBGET integrated database retrieval system