Mus pahari (shrew mouse): 110329114 Help Entry 110329114         CDS       T05929                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism mpah  Mus pahari (shrew mouse) Pathway mpah04613   Neutrophil extracellular trap formation mpah05034   Alcoholism mpah05202   Transcriptional misregulation in cancer mpah05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mpah00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     110329114  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     110329114   09163 Immune disease    05322 Systemic lupus erythematosus     110329114   09165 Substance dependence    05034 Alcoholism     110329114  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mpah03036]     110329114   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mpah04147]     110329114 Chromosome and associated proteins [BR:mpah03036]  Eukaryotic type   Nucleosome assembly factors    Histones     110329114 Exosome [BR:mpah04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110329114 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C Motif Other DBs NCBI-GeneID:  110329114 NCBI-ProteinID:  XP_021064345 LinkDB All DBs Position 1:95636853..95639188 Genome browser AA seq 141 aa AA seqDB search MPCAHTISRTKQTAGKSTGGEPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALHEIRHY QKSTEFLIHKLLFQSLVGEIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDINLCTNHA KCVTMMPKDIQLAHHICRERA NT seq 426 nt NT seq  +upstreamnt  +downstreamnt atgccgtgtgcccacaccatttctcgtacaaagcagactgctggcaaatccaccggtggt gaacccaggaaacaactggctacaaaagctgctcgcaagagtgcaccctctactggaggg gtgaagaaacctcatcgttacaggcctggtactgtggcactccatgaaatcagacactat cagaagtccactgaattcctgattcacaagctgctctttcagagtctggtgggagaaatt gctcaggacttcaaaacagatctgcgcttccagagtgcagctattggtgctttgcaggag gcaagtgaggcctatctggttggcctttttgaagatatcaacctgtgcactaaccatgcc aaatgtgtaaccatgatgccaaaagatatccagctagcacaccacatatgcagagaacgt gcttaa

DBGET integrated database retrieval system