KEGG   Mus pahari (shrew mouse): 110329143
Entry
110329143         CDS       T05929                                 

Gene name
Polk
Definition
(RefSeq) DNA polymerase kappa isoform X1
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah03460  Fanconi anemia pathway
mpah05169  Epstein-Barr virus infection
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05210  Colorectal cancer
mpah05212  Pancreatic cancer
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05216  Thyroid cancer
mpah05217  Basal cell carcinoma
mpah05218  Melanoma
mpah05220  Chronic myeloid leukemia
mpah05222  Small cell lung cancer
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    110329143 (Polk)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110329143 (Polk)
   05202 Transcriptional misregulation in cancer
    110329143 (Polk)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110329143 (Polk)
   05212 Pancreatic cancer
    110329143 (Polk)
   05225 Hepatocellular carcinoma
    110329143 (Polk)
   05226 Gastric cancer
    110329143 (Polk)
   05214 Glioma
    110329143 (Polk)
   05216 Thyroid cancer
    110329143 (Polk)
   05220 Chronic myeloid leukemia
    110329143 (Polk)
   05217 Basal cell carcinoma
    110329143 (Polk)
   05218 Melanoma
    110329143 (Polk)
   05213 Endometrial cancer
    110329143 (Polk)
   05224 Breast cancer
    110329143 (Polk)
   05222 Small cell lung cancer
    110329143 (Polk)
   05223 Non-small cell lung cancer
    110329143 (Polk)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    110329143 (Polk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mpah03400]
    110329143 (Polk)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     110329143 (Polk)
DNA repair and recombination proteins [BR:mpah03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    110329143 (Polk)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH ATP-cone zf-C2H2_12
Other DBs
NCBI-GeneID: 110329143
NCBI-ProteinID: XP_021064385
Ensembl: MGP_PahariEiJ_G0015882
LinkDB
Position
11
AA seq 850 aa
MDNTKEKDTNFRDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQV
NQRIENMMQQKAQITSQQLRKAQLQVDRFAMELERNRNLNNTIVHVDMDAFYAAVEMRDK
PELKDKPIAVGSMSMLATSNYHARRFGVRAAMPGFIAKRLCPQLIIVPPNFDKYRAVSKE
VKEILAEYDPNFMAMSLDEAYLNITQHLQERQDWPEDKRRYFIKMGNCLKIDTPRQEANE
LTEYERPISPLLFEDSPPDLQPQGSPFQLNSEEQNNPQITQNPVVFGTSAEEVVKEIRFR
IEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPSRSAVMDFIKDLPIRKVSGIGKV
TEKMLLALGIVTCTELYQQRALLSLLFSETSWHYFLHIALGLGSTDLARDGERKSMSVER
TFSEISNTEEQYSLCQELCAELAHDLQKEGLKGRTVTIKLKNVNFEVKTRASTVPAALST
AEEIFAIAKELLRTEVNVGSPHPLRLRLMGVRMSTFSNEGDKNHQQRSIIGFLQAGNQAL
SATGSSLDKTDKTECAKPLEKKSFFDKKRSERISNCQDTSRCNTADQQALQISEPSQALK
KLSESFETSENSNDCQTFICPVCFREQEGVSLETFNEHVDECLDGPSTSDNSKMPCYSHA
SSADIRQKEDVYPSIPLCEKQGHENGEITSVDDVDLTGTEDRSLKAASMDTLENNRSKEE
YPDVPDKSCPISLANETISTSSRQESVQPCTDEVVTGQALVCPVCNLEQETSDLALFNIH
VDICLNKGIIQELRNSESNSVKQPKESSRSTDRLQKASGRTKRPGLKTKSTTSKKTKPHN
PRHTLDGFLK
NT seq 2553 nt   +upstreamnt  +downstreamnt
atggataacacaaaggaaaaggacaccaacttcagagacgaccttctgctccgcatggga
ctaaatgataacaaggcaggcatggaagggttggataaggagaaaattaacaaaattatc
atggaagccacaaaggggtccagattttacggaaatgagctgaagaaggaaaagcaagtc
aatcaacggattgaaaatatgatgcaacaaaaagctcaaattaccagccagcaactaagg
aaagctcaattacaggttgacagatttgcaatggagttagaacggaaccggaacttgaac
aataccatagttcatgttgacatggacgctttctatgcagcagtagaaatgagggacaag
ccagagctgaaggataaacccattgccgtaggatccatgagcatgttggctacttcaaat
taccatgcaaggaggtttggtgtccgtgcagccatgccaggatttattgctaagaggctc
tgcccacaacttattatagtgcccccaaactttgacaaatatagagctgtgagtaaggag
gttaaggagatacttgctgaatatgatcccaattttatggccatgagtctggatgaagcc
tacttgaatataacacagcacttgcaggaaaggcaagattggcctgaggacaaaagaaga
tatttcatcaaaatgggaaactgcttaaaaatcgatacacccagacaggaagctaacgag
ctgaccgagtatgagcggcccatctccccgctgctttttgaagatagtcctcctgatttg
caaccccaaggaagtcctttccaactgaactctgaagaacaaaacaatcctcaaataacc
caaaatccagttgtttttggaacatcagctgaggaagtggtaaaggaaattcgcttcaga
attgaacaaaaaacaacgctgacagccagtgcaggcattgcccccaatacaatgttagca
aaagtgtgcagtgataagaataagccaaacggacagtaccaaatcctccccagcaggagc
gcagtgatggacttcatcaaggacctgcctattagaaaggtttctggaataggaaaagtg
acagagaaaatgttactggctctcgggattgttacttgcacagaactctaccaacagaga
gcattgctgtctctccttttctctgagacatcttggcattattttcttcacatcgcactg
ggtctaggttcaacagacctggcaagggatggagaaaggaaaagcatgagcgtagaaagg
acattcagtgagataagtaacacagaggaacagtacagcttgtgccaagaactgtgcgct
gagctcgcccatgacctccagaaggaaggacttaagggaagaactgttaccattaagctg
aagaacgtgaattttgaagtaaaaactcgtgcatctacagttccggctgccctttctact
gcagaggaaatatttgccattgccaaggagctgctaagaacagaagttaatgtgggttct
ccacatcccctgcggttaagactgatgggtgtccgaatgtctaccttttccaatgaaggt
gacaagaaccaccaacaaaggagcatcattggcttcttacaagctggaaaccaagctctg
tcagctactgggtctagtctagacaaaactgacaaaactgagtgtgcaaagcccttagaa
aagaagagtttctttgataaaaagcgatcagaaagaatctccaactgtcaagacacatcc
agatgtaatactgcagatcagcaagctttacagatctcggaaccatcccaagcattaaag
aagctgagcgagagttttgaaacatcagagaattcaaatgactgtcagacatttatatgt
ccagtttgctttagggagcaagaaggtgtcagtctggaaacctttaatgaacatgtagat
gagtgtcttgatgggccatccaccagtgacaactcaaaaatgccctgttactcacacgct
tcctctgcagacattcgtcagaaggaagatgtatacccctctattccactgtgtgagaaa
caggggcatgaaaatggagagatcacttcagtagatgatgtagatctaacagggacggaa
gacagatcactgaaagcagcaagtatggacactctagagaataatcgcagcaaagaggaa
tatcctgatgttccagacaagtcttgtcctatatcattggcaaatgaaaccatcagtaca
tcaagtagacaagaatctgtccagccttgtacagatgaggtagtaacaggacaagctcta
gtgtgtcctgtctgtaacctagaacaagagacttctgatcttgccctcttcaacatacat
gtggatatttgcttaaataaaggtattatccaagaactgagaaatagtgaaagtaattca
gttaaacaacccaaagaaagctcgagaagtactgacagacttcagaaggcttcgggaagg
actaaaaggccaggactgaagacgaagagcacaacatcgaagaaaacaaagccccacaac
cccagacacacccttgatggatttttaaaatga

DBGET integrated database retrieval system