KEGG   Mus pahari (shrew mouse): 110329750
Entry
110329750         CDS       T05929                                 

Gene name
Snai2
Definition
(RefSeq) zinc finger protein SNAI2
  KO
K05706  snail 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
mpah04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110329750 (Snai2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110329750 (Snai2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110329750 (Snai2)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 Snail
    110329750 (Snai2)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_jaz zf-C2H2_6 zf-Di19 zf-met zf-C2HE zf-BED zinc_ribbon_15 Elf1 Ogr_Delta Zn-ribbon_8 zf-H2C2_5 DUF4764 Zn_Tnp_IS1595
Other DBs
NCBI-GeneID: 110329750
NCBI-ProteinID: XP_021065255
Ensembl: MGP_PahariEiJ_G0016188
LinkDB
Position
12
AA seq 269 aa
MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYPMPVIPKPEILTSGAYSPITVWT
SSAAPFHSPLPSGLSPLTGYSSSLGRVSPPPSSDTSSKDHSGSESPISDEEERLQPKLSD
PHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIR
THTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVK
KYQCKNCSKTFSRMSLLHKHEESGCCVAH
NT seq 810 nt   +upstreamnt  +downstreamnt
atgccgcgctccttcctggtcaagaaacatttcaacgcctccaagaagcccaactacagc
gaactggacacacacacagttatcatttccccatatctctatgaaagttaccccatgcct
gtcataccaaaaccagagatcctcacctcgggagcatacagccctattactgtatggaca
tcttcggcagctccattccactctcctctacccagtggcctttctcctcttactggatac
tcctcatccttggggcgtgtaagccccccaccttcctctgacacttcatccaaggatcac
agtggttcagaaagtcccattagtgacgaagaggagagactgcagcccaagctttcagac
ccccatgccattgaagctgagaagtttcagtgcaatttatgcaataagacctattctact
ttctctgggctggccaaacacaagcagctgcactgtgacgcccagtctaggaaatcgttc
agctgcaaatactgtgacaaggaatatgtgagcctgggtgccctgaagatgcacattcga
acccacacattgccttgtgtctgcaagatctgtggcaaggctttctccagaccctggctg
cttcaaggacacattagaactcacactggggaaaagcctttctcttgccctcactgcaat
agggcttttgcagacagatcaaacctgagggcacatctgcagacccactctgatgtaaag
aaataccagtgcaaaaactgctccaaaaccttctccagaatgtcgcttctgcataaacat
gaggagtctggctgctgtgtggcacattga

DBGET integrated database retrieval system