KEGG   Mus pahari (shrew mouse): 110330048
Entry
110330048         CDS       T05929                                 

Gene name
Crebbp
Definition
(RefSeq) CREB-binding protein isoform X1
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04024  cAMP signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04068  FoxO signaling pathway
mpah04110  Cell cycle
mpah04310  Wnt signaling pathway
mpah04330  Notch signaling pathway
mpah04350  TGF-beta signaling pathway
mpah04520  Adherens junction
mpah04630  JAK-STAT signaling pathway
mpah04720  Long-term potentiation
mpah04916  Melanogenesis
mpah04919  Thyroid hormone signaling pathway
mpah04922  Glucagon signaling pathway
mpah04935  Growth hormone synthesis, secretion and action
mpah05016  Huntington disease
mpah05152  Tuberculosis
mpah05161  Hepatitis B
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05200  Pathways in cancer
mpah05203  Viral carcinogenesis
mpah05206  MicroRNAs in cancer
mpah05211  Renal cell carcinoma
mpah05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110330048 (Crebbp)
   04330 Notch signaling pathway
    110330048 (Crebbp)
   04350 TGF-beta signaling pathway
    110330048 (Crebbp)
   04630 JAK-STAT signaling pathway
    110330048 (Crebbp)
   04066 HIF-1 signaling pathway
    110330048 (Crebbp)
   04068 FoxO signaling pathway
    110330048 (Crebbp)
   04024 cAMP signaling pathway
    110330048 (Crebbp)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110330048 (Crebbp)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110330048 (Crebbp)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    110330048 (Crebbp)
   04935 Growth hormone synthesis, secretion and action
    110330048 (Crebbp)
   04919 Thyroid hormone signaling pathway
    110330048 (Crebbp)
   04916 Melanogenesis
    110330048 (Crebbp)
  09156 Nervous system
   04720 Long-term potentiation
    110330048 (Crebbp)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110330048 (Crebbp)
   05206 MicroRNAs in cancer
    110330048 (Crebbp)
   05203 Viral carcinogenesis
    110330048 (Crebbp)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    110330048 (Crebbp)
   05215 Prostate cancer
    110330048 (Crebbp)
  09164 Neurodegenerative disease
   05016 Huntington disease
    110330048 (Crebbp)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110330048 (Crebbp)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110330048 (Crebbp)
   05161 Hepatitis B
    110330048 (Crebbp)
   05164 Influenza A
    110330048 (Crebbp)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110330048 (Crebbp)
   05165 Human papillomavirus infection
    110330048 (Crebbp)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110330048 (Crebbp)
   03036 Chromosome and associated proteins [BR:mpah03036]
    110330048 (Crebbp)
   03029 Mitochondrial biogenesis [BR:mpah03029]
    110330048 (Crebbp)
Enzymes [BR:mpah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     110330048 (Crebbp)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    110330048 (Crebbp)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    110330048 (Crebbp)
Mitochondrial biogenesis [BR:mpah03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    110330048 (Crebbp)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 110330048
NCBI-ProteinID: XP_021065636
Ensembl: MGP_PahariEiJ_G0016106
LinkDB
Position
12
AA seq 2442 aa
MAENLLDGPPNPKRAKLSSPGFSANDNTDFGSLFDLENDLPDELIPNGELSLLNSGNLVP
DAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLGGQAQGQPNSTNMGSLGAMGKS
PLNQGDSSTPNLPKQAASTSGPTPPASQALNPQAQKQVGMVTSSPATSQTGPGICMNANF
NQTHPGLLNSNSGHSLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPAPAMQGATSSVLAE
TLTQVSPQMAGHAGLNTAQAGGMTKMGMTGTTSPFGQPFSQTGGQQMGATGVNPQLASKQ
SMVNSLPAFPTDIKNTSVTTVPNMSQLQTSVGIVPTQAIATGPTADPEKRKLIQQQLVLL
LHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKN
CTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNATSLSNPNPIDPSSM
QRAYAALGLPYMNQPQTQLQPQVPGQQPAQPPAHQQMRTLNALGNNPMSIPAGGITTDQQ
PPNLISESALPTSLGATNPLMNDGSNSGNIGNLSTIPTAAPPSSTGVRKGWHEHVTQDLR
SHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKI
QKELEEKRRSRLHKQGILGNQPALPAPGAPPPVIPPAQSVRPPNGPLPLPVNRMQVSQGM
NSFNPMSLGNVQLPQAPMGPRAASPMNHSVQMNSMASVPGMAISPSRMPQPPNLMGTHAN
NIMGQAPTQNQFLPQNQFPSSSGAMSVNSVGMGQPTAQAGVSQGQVPGGTLPSPLNMLAP
QASQLPCPPVTQSPLHPTPPPASTAAGMPSLQHPTAPGMTPPQPAAPTQPSTPVSSGQTP
TPTPGSVPSAAQTQSTPTVQTAAQAQVTPQPQTPVQPPSVTTPQSSQQQPTPVHTQPPGT
PLSQAAASIDNRVPTPSSVTSAETSSQQPGPDVPMLEMKTEVQTDDAEPDPTESKGEPRS
EMMEEDLQGSSQVKEETDTTEQKSEPMEVEEKKPEVKVDAKEEEENSANGTASQSTSPSQ
PRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIK
RKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYC
CGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQ
TTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPR
KENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRF
VDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHF
FRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRL
QEWYKKMLDKAFAERIINDYKDIFKQANEDRLTSAKELPYFEGDFWPNVLEESIKELEQE
EEERKKEESTAASETPEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQ
KLYATMEKHKEVFFVIHLHAGPVISTQPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFS
SLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHT
HKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMK
RVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRL
QQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVNMSPA
GFPNVARTQPPTIVSAGKPTNQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRANINN
GMPPGRAGMGTPGSQMAPVGLNVPRPNQVSGPVMSSMPPGQWQQAPIPQQQPMPGMPRPV
MSMQAQAAVAGPRMPNVQPPRSISPSALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAA
FIKQRTAKYVANQPGMQPQPGLQSQPGMQPQPGMHQQPSLQNLNAMQAGVPRPGVPPPQP
AMGGLNPQGQALNIMNPGHNPNMANMNPQYREMVRRQLLQHQQQQQQQQQQQQQQQQNSA
SLAGGMAGHNQFQQPQGPGGYAPAMQQQRMQQHLPIQGSSMGQMAAPMGQLGQMGQPGLG
ADSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQIATSLS
NQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSMDQGHL
GNPEQSAMLPQLNTPNRSALSSELSLVGDTTGDTLEKFVEGL
NT seq 7329 nt   +upstreamnt  +downstreamnt
atggccgagaacttgctggacggaccgcccaaccccaaacgagccaaactcagctcgccc
ggcttctccgcgaatgacaacacagattttggatcattgtttgacttggaaaatgatctt
cctgatgagctgatccccaatggagaattaagccttttaaacagtgggaaccttgttcca
gatgctgcgtccaaacataaacaactgtcagagcttcttagaggaggcagcggctctagc
atcaacccagggataggcaatgtgagtgccagcagccctgtgcaacagggccttggtggc
caggctcaggggcagccgaacagtacaaacatgggcagcttaggtgccatgggcaagagc
cctctgaaccaaggagactcatcaacacccaatctgcccaaacaggcagccagcacctct
gggcccactccccctgcctcccaagcactgaatccgcaagcacaaaagcaagtagggatg
gtgaccagtagtcctgccacatcacagactggacctgggatctgcatgaatgctaacttc
aaccagacccacccaggccttctcaatagtaactctggccatagcttaatgaatcaggct
caacaagggcaagctcaagtcatgaatggatctcttggggctgctggcagaggaagggga
gctggaatgccctaccctgctccagccatgcagggggccacaagcagtgtgctggcagag
accttgacccaggtttccccacaaatggctggccatgctggactgaatacggcacaggca
ggaggcatgaccaagatgggaatgactggtaccacaagtccatttggacaaccctttagt
caaactggaggacagcagatgggagccactggagtgaacccccaattagccagcaaacag
agcatggtcaatagtttacctgcttttcctacagatatcaagaatacttcagtcaccact
gtgccaaatatgtcccagttacaaacatcagtgggaattgtacccacacaagcaattgca
acaggccccacagcagaccctgaaaaacgcaaactgatacagcagcagctggttctactg
cttcatgcccacaaatgtcagagacgagagcaagcgaatggagaggttcgagcctgttct
ctcccgcactgtcgaaccatgaaaaacgttttgaatcacatgacacattgtcaggctggg
aaagcctgccaagttgcccattgtgcatcttcacgacaaatcatctctcattggaagaac
tgcacacgacatgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcgaaac
caacaaaccatcctgggatctccagctagtggaattcaaaacacaattggttctgttggt
acagggcaacagaatgccacttctttaagtaacccaaatcccatagaccccagttccatg
cagcgggcctatgctgctctaggactcccctacatgaaccagcctcagacacagctgcag
cctcaggttcctggccagcaaccagcacagcctccagcccaccagcagatgaggactctc
aacgccctaggaaacaaccccatgagtattccagcaggaggaataacaacagatcaacag
ccaccaaacttgatttcagaatcagctcttccaacttccttgggggctaccaatccactg
atgaatgatggttcaaactctggtaacattggaaacctcagcacgatacccacagcagcg
cctccttctagcactggtgttcgaaaaggctggcatgaacatgtgactcaggacctacgg
agccatctagtccataaactggttcaagccatcttcccgactccagaccctgcagctctg
aaagatcgccgcatggagaacctggttgcctatgctaagaaagtggagggagacatgtat
gagtctgctaatagcagggatgaatattatcatttattagcagagaaaatctataaaata
caaaaggaactagaagaaaaacggaggtcacgtttacataagcaaggcatcctgggtaac
cagccagctttaccagctcccggggctccgccccctgtgatcccaccagcccagtctgta
cgacctccaaatgggcccctgcctttgccagtgaatcgcatgcaggtttctcaagggatg
aattcatttaacccaatgtccctgggaaacgtccagttgccacaggcacccatgggacct
cgtgcagcctcccctatgaaccactctgtccagatgaacagcatggcctcagttcccggt
atggccatttctccttcacggatgcctcagcctccaaatttgatgggcacccatgccaac
aacattatgggccaggcacctactcagaaccagtttctgccacagaaccagtttccatca
tccagtggggcaatgagtgtgaacagtgtgggcatggggcagccaacagcccaggcaggt
gtttcacagggccaggtgcctggaggtactctccctagccctctgaacatgctggcaccc
caggccagccagctgccttgcccaccagtgacacagtcaccgttgcacccgactccacct
cctgcttccacagctgctggcatgccctctctccaacatccaacggcacctgggatgacc
cctccccagccagcagctcccactcagccatccactcctgtgtcatctggccagactcct
accccaactcctggctcagtgcccagcgctgcccaaacacagagtacccctacagtccag
acagcagcacaggctcaggtgaccccacagcctcagaccccagtgcagccaccatctgtg
actactcctcagtcatcacagcagcaaccaacgcctgtgcatacccagcctcctggcaca
ccgctttctcaggcagcagctagcattgataatagagtccctactccctcctctgtgacc
agtgctgaaaccagttcccagcagccaggacctgatgtgcccatgctggaaatgaagaca
gaggtgcagacagatgatgctgagcctgatcctactgaatccaagggggaacctcggtct
gagatgatggaagaggatttacaaggttcttcccaagtaaaagaagaaacagatacaaca
gagcagaagtcagaaccaatggaagtagaagaaaagaaacccgaagtaaaagtggacgct
aaagaggaagaagagaacagtgctaatggcacagcctcacaatcaacatctccttcccag
ccacgcaaaaaaatctttaaacccgaggagctacgccaggcacttatgccaactctagaa
gcactctatcgacaggacccagagtctttgccttttcgtcagcctgtagatcctcagctc
ctaggaatcccagattattttgatattgtgaagaatcctatggacctttctaccatcaaa
cgaaagctggacacagggcagtatcaagaaccctggcagtatgtggatgatgtctggctt
atgttcaacaatgcgtggctatataatcgtaagacgtcccgtgtatataaattttgcagt
aaacttgcagaggtctttgaacaagaaattgaccctgtcatgcagtctcttggatattgc
tgtggacgaaagtatgagttctccccacagactttgtgctgttatggaaagcagctgtgt
acaattcctcgtgatgcagcctactacagctatcagaataggtatcatttctgtgagaag
tgtttcacagagatccagggcgagaatgtgaccctgggtgacgacccttcccaacctcag
acgacaatttccaaggatcaatttgaaaagaagaaaaatgatactttagatcctgaacct
tttgttgactgcaaagaatgtggccggaagatgcatcagatttgtgttctacactatgac
atcatttggccttcaggatttgtgtgtgacaactgcttgaagaaaactggcagacctcgg
aaagaaaacaaattcagtgctaagaggctgcagaccacacgattgggaaaccacttggaa
gaccgagtgaataagtttttgcggcgccagaatcaccctgaagctggggaggtttttgtc
agagtggtggccagctcagacaagactgtggaggtcaagccgggaatgaagtcaaggttt
gtggattctggagaaatgtctgaatctttcccgtatcgtaccaaagcactcttcgctttt
gaggagatcgatggagtcgatgtgtgcttttttgggatgcatgtgcaagaatacggctct
gattgccccccaccaaatacaaggcgtgtatacatatcttatctggacagtattcatttt
ttccggccccgctgcctccggacagctgtttaccatgagatcctcattggatatctagag
tatgtgaagaagttggggtatgtgacaggacacatttgggcctgtcccccaagtgaagga
gatgactatatctttcattgccaccctcctgaccagaaaatccccaaaccaaaacgacta
caggagtggtacaagaagatgctggacaaagcgttcgcagagaggatcattaacgactat
aaggacatcttcaaacaagcgaacgaagacagactcacgagtgccaaggagttgccctat
tttgaaggcgatttctggcctaatgtgttggaagaaagcattaaggaactagaacaagaa
gaagaagagaggaaaaaagaagagagtactgcagcgagtgagactcctgagggcagtcag
ggtgacagcaaaaatgccaagaaaaagaacaacaagaagaccaacaaaaacaaaagcagc
attagccgcgccaacaagaagaagcccagcatgcccaatgtttccaacgacctgtcacag
aagctgtatgccaccatggagaagcacaaggaggtattctttgtgattcatctgcatgct
gggcctgttatcagcactcagccccccatcgtggacccggatccactgcttagctgtgac
ctcatggatgggcgtgatgccttcctcaccctggccagagacaagcactgggaattctct
tccttacgccgctccaaatggtccactctgtgcatgctggtggagctgcacacacagggc
caggaccgctttgtctatacctgcaatgagtgcaaacaccatgtggaaacacgctggcac
tgcactgtgtgtgaggactatgacctttgtatcaattgctacaacacaaagagccacacc
cataagatggtgaagtgggggctaggcctagatgatgagggcagcagtcagggtgagcca
cagtccaagagcccccaggaatcccggcgtctcagcatccagcgctgcatccagtccctg
gtgcatgcctgccagtgtcgcaatgccaactgctcgctgccatcttgccagaagatgaag
cgagtcgtgcagcacaccaagggctgcaagcgcaagactaatggaggatgcccagtgtgc
aagcagctcattgctctttgctgctaccatgccaaacactgccaagaaaataaatgccct
gtgcccttctgcctcaacatcaaacacaagctccgccagcagcagatccagcatcgcctg
cagcaggctcagctcatgcgccggcgaatggcaaccatgaacacccgcaatgtgcctcag
cagagtttgccttctcctacctcagcaccacccgggactcctacacagcagcccagcaca
ccccaaacaccacagcccccagcccagcctcagccttcacctgttaacatgtcaccagct
ggcttccctaatgtagcccggactcagccccccacaatagtgtctgctgggaagcctacc
aaccaggtgccagctcccccaccccctgcccagcccccacctgcagcagtagaagcagcc
cggcaaattgaacgtgaggcccagcagcagcagcacctataccgagcaaacatcaacaat
ggcatgcccccagggcgtgcaggtatggggaccccaggaagccaaatggctcctgtgggc
ctgaatgtgccccgccccaaccaagtcagtgggcctgtcatgtctagcatgccacctggg
cagtggcagcaggcacccatccctcagcagcagccgatgccaggcatgcccaggcctgta
atgtccatgcaggcccaggcagccgtggctgggccacggatgcccaatgtgcagccaccc
aggagcatctcgccaagtgccctgcaagacctgcttcggaccctaaagtcacccagctct
cctcaacagcagcagcaggtgctgaacatcctcaaatcaaacccacagctaatggcagct
ttcatcaaacagcgcacagccaagtatgtggctaatcagcctggcatgcagccccagccc
ggacttcaatcccagcctggtatgcagccccagcctggcatgcaccagcagcctagcttg
caaaatctgaacgcaatgcaagctggtgtgccacggcctggtgtgcctccaccacaaccg
gcaatgggaggcctgaacccccagggacaggctctgaacatcatgaacccaggacacaac
cccaacatggcaaacatgaatccacagtaccgagaaatggtgaggagacagctgctacag
caccaacaacagcagcagcagcagcaacagcagcagcaacaacaacaacaaaacagtgcc
agcttggccgggggcatggcaggacacaaccagttccagcagccacaaggacctggaggc
tatgccccagccatgcagcagcaacgcatgcaacagcacctccccatccagggcagctcc
atgggccagatggctgctccaatgggacaacttggccagatggggcagcctgggctaggg
gcagacagcacccctaatatccagcaggccctgcagcaacggattctgcagcagcagcag
atgaagcaacaaattgggtcaccaggccagccgaaccccatgagcccccagcagcacatg
ctctcaggacagccgcaggcctcacatctccctggccagcagattgccacatcccttagt
aaccaggtgcggtctccagcccctgtgcagtctccaaggccccagtcccagcctccacat
tccagcccgtcaccacggatacagccccagccttcaccacaccatgtttcaccccagact
ggttcccctcaccccggactcgcagtcaccatggccagctccatggatcagggacacctg
gggaaccctgaacagagtgcaatgctcccccagctgaatacccccaacaggagcgcactg
tccagtgaactgtccctggttggtgacaccacgggagacacgctagaaaagtttgtggag
ggtttgtag

KEGG   Mus pahari (shrew mouse): 110334526
Entry
110334526         CDS       T05929                                 

Gene name
Ep300
Definition
(RefSeq) histone acetyltransferase p300
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04024  cAMP signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04068  FoxO signaling pathway
mpah04110  Cell cycle
mpah04310  Wnt signaling pathway
mpah04330  Notch signaling pathway
mpah04350  TGF-beta signaling pathway
mpah04520  Adherens junction
mpah04630  JAK-STAT signaling pathway
mpah04720  Long-term potentiation
mpah04916  Melanogenesis
mpah04919  Thyroid hormone signaling pathway
mpah04922  Glucagon signaling pathway
mpah04935  Growth hormone synthesis, secretion and action
mpah05016  Huntington disease
mpah05152  Tuberculosis
mpah05161  Hepatitis B
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05200  Pathways in cancer
mpah05203  Viral carcinogenesis
mpah05206  MicroRNAs in cancer
mpah05211  Renal cell carcinoma
mpah05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110334526 (Ep300)
   04330 Notch signaling pathway
    110334526 (Ep300)
   04350 TGF-beta signaling pathway
    110334526 (Ep300)
   04630 JAK-STAT signaling pathway
    110334526 (Ep300)
   04066 HIF-1 signaling pathway
    110334526 (Ep300)
   04068 FoxO signaling pathway
    110334526 (Ep300)
   04024 cAMP signaling pathway
    110334526 (Ep300)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110334526 (Ep300)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110334526 (Ep300)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    110334526 (Ep300)
   04935 Growth hormone synthesis, secretion and action
    110334526 (Ep300)
   04919 Thyroid hormone signaling pathway
    110334526 (Ep300)
   04916 Melanogenesis
    110334526 (Ep300)
  09156 Nervous system
   04720 Long-term potentiation
    110334526 (Ep300)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110334526 (Ep300)
   05206 MicroRNAs in cancer
    110334526 (Ep300)
   05203 Viral carcinogenesis
    110334526 (Ep300)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    110334526 (Ep300)
   05215 Prostate cancer
    110334526 (Ep300)
  09164 Neurodegenerative disease
   05016 Huntington disease
    110334526 (Ep300)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110334526 (Ep300)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110334526 (Ep300)
   05161 Hepatitis B
    110334526 (Ep300)
   05164 Influenza A
    110334526 (Ep300)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110334526 (Ep300)
   05165 Human papillomavirus infection
    110334526 (Ep300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110334526 (Ep300)
   03036 Chromosome and associated proteins [BR:mpah03036]
    110334526 (Ep300)
   03029 Mitochondrial biogenesis [BR:mpah03029]
    110334526 (Ep300)
Enzymes [BR:mpah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     110334526 (Ep300)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    110334526 (Ep300)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    110334526 (Ep300)
Mitochondrial biogenesis [BR:mpah03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    110334526 (Ep300)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ ZZ DUF902 KIX_2 Npa1
Other DBs
NCBI-GeneID: 110334526
NCBI-ProteinID: XP_021071924
Ensembl: MGP_PahariEiJ_G0020056
LinkDB
Position
17
AA seq 2336 aa
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTDLGLTNGGD
ISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQVMASQAQQNSPGLSLINS
MVKSPMAQTGLTSPNMGMGSSGPNQGPTQSPAGMMNSPVNQPAMGMNTGMNAGMNPGMLA
AGNGQGILPNQVMNGSIGTGRGRPNMQYPNAGMGSAGSLLTEPLQQGSPQMGGQPGLRGP
QPLKMGMMNNPSPYGSPYTQNSGQQIGASGLGLQIQTKTVLPNNLSPFAMDKKAVPGGGV
PSMGQQPTPSVQQPGLVTPVAPGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANG
EVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKN
AGDKRNQQSILTGAPVGVNNTSSLGVGPQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQ
IPPQPQVQAKNQQSQPSGQSPQGMRSMNNMSASPMGVNGGVGVQTPNLLSDSMLHSTINS
QNPMMSENAGVASLGPLPTAAQPSSTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAA
LKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLP
SGPGMVPGPMNTGPNMGPQPTGMTTNGPVPDPSMIRGSVPNHMMPRLTPQPGLNQFGQMN
MPQPPIGPRQPSPLQHHGQLAQSGSLNPAMGYGPRMQQASGQNQFLSQTQFPSQGMNVTN
MPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPSLPQQAHQNSPSPVPSRTP
TPHHTPPSIGTQPPPATAIPAPVPTPPAIPPGPQPPSLHPSSRQTPTPPTHLPPPVQPSL
PAAPSADQSQQQPRSQQSTAASVPTPTAPLLPPQPSTPLSQPAVSIEGQVSNPPSTSSTE
VNSQNIPEKQPSQEVKMEAKMEVDQPEPADAQPDDTKETKAEDVKVEPTEMEERGSELKT
EVKEEEDQPNTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDP
QLLGIPLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNEIQGESVSLGDDPSQ
PQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPSGFVCDGCLKKTAR
TRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKA
RFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSV
HFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPK
RLQEWYKKMLDKAVSERIVHDYKDILKQATEDRLTSAKELPYFEGDFWPNVLEESIKELE
QEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLS
QKLYATMEKHKEVFFVIRLIACPAPNSLPPIVDPDPLIPCDLMDGRDAFLTLARDKHLEF
SSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNH
DHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKM
KRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQLQHR
LQQAQMLRRRMASMQRTGVAGQQQGLPSPTPATPTTPTGQQPATPQTPQPQPTSQPQPTP
PNNMTPYLPRTQTTGPVSQGKAAGQVTPPTPPQTAQAPLPGPPPAAVEMAMQIQRAAETQ
RQMAHVQIFQRPIQHQMPQMAPMAPMGMNPPPMARGPGGHLDPGIGPTGMQQQPPWAQGG
MPQPQQMQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGVSPLKPGTVSQQALQNLLRTLR
SPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANPNPQPLPGQPGMPQGQPGLQPPTMP
GQQGVHSNPALQNMNPLQAGVQRAGLPQQQPQQQQLQPPMGAMSPQAQQMNMNHNTMPSQ
FRDILRRQMMQQQGAGPGIGPGMANHNQFQQPQGIGYPPQQQQQQQRMQHHMQQMQQGNM
GQMGQLPQALGAEAGASLQAYQQRLLQQQMGSPAQPNPMSPQQHMLPNQAQSPHLQGQQI
PNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQAANP
MEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSSDNADLNSNLSQSTLDIH
NT seq 7011 nt   +upstreamnt  +downstreamnt
atggccgagaatgtggtggaacccgggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcgtccgccagcgatggcacagattttggttcactgtttgacctggaa
catgacttaccagatgaattaatcaactctacagacttgggactaaccaatggtggcgat
attagtcagcttcagacaagtcttggcatagtacaagatgcagcctctaaacataaacag
ctgtcagaattgctaaggtctggtagttcccctaacctcaacatgggagttggtggccca
ggccaagttatggccagccaggcccaacagaacagccctggattaagtttgataaatagc
atggtcaaaagcccaatggcacagacaggcttgacttctcctaacatggggatgggcagt
agtggaccaaatcagggtcctactcagtccccagcaggtatgatgaacagtccagtgaat
cagcctgccatgggaatgaacacagggatgaatgctggcatgaatcctgggatgttggct
gcaggcaatggacaagggatactgcccaatcaagtcatgaatggttccattggaacaggc
cggggacggccaaacatgcagtacccaaacgcaggcatgggcagtgctggcagtttattg
actgagccactacagcagggctctcctcagatgggaggacaaccaggattgagaggcccc
caaccacttaagatgggaatgatgaacaatcccagtccttatggttcaccatacactcag
aattctggacagcagattggagcaagtggccttggtctccaaattcagacaaagactgtt
ctaccaaataacttatctccatttgccatggacaaaaaggcagtgcctggtgggggagtg
cccagtatgggccaacagcctaccccatcggtccagcagccaggcctggtgactccagtt
gccccagggatgggttctggagcgcacacagctgatccagagaagcgcaagctcatccag
cagcagctggtactccttttacatgctcacaagtgccagcgccgggagcaagctaatggg
gaagtgaggcagtgcaatcttccccactgtcgtaccatgaaaaatgtcctaaaccatatg
acacactgccagtcaggcaaatcctgccaagtggcacattgtgcatcttctcgacaaatc
atttcacactggaaaaattgcacaaggcatgattgtcctgtgtgtcttcctctcaaaaat
gctggggataagcgaaatcaacagtcaattttgacaggagcaccagttggggttaataac
actagctctctaggagtggggccacagtccacccctagcctaagcactgttagtcagatt
gaccccagctctatagagcgagcttacgctgctcttggactaccctatcaagtcaaccag
attccaccacaaccccaggtacaagcaaagaatcaacaaagtcagccatctggacagtct
ccccagggcatgcggtctatgaacaacatgagtgctagtcctatgggtgtaaatggaggt
gtaggggttcagacgccgaatcttctttctgactccatgttgcattcaaccataaattct
caaaacccgatgatgagtgaaaatgctggtgtggcctccctgggtcctttgccaacagca
gctcagccatctagtactggaattcgaaaacagtggcatgaagatattactcaggatctt
cgaaaccaccttgttcataaacttgttcaagccatatttcccactccggatcctgctgct
ttaaaagaccgacggatggaaaaccttgttgcatatgctcgtaaggtggaaggggacatg
tatgaatctgcaaacaatagagctgaatactatcacctcttagccgagaagatctataag
atccagaaggaactagaagagaaacggaggactagactacagaaacagaacatgctacca
agtggtcctggcatggttccagggcctatgaatactggacctaacatggggccgcaacca
acaggaatgactaccaatggtcctgtgcctgacccgtctatgatccgtggcagtgtgccg
aaccacatgatgcctcggttgactccacaacctggtttgaatcaatttgggcaaatgaat
atgccacagcctcctattggaccccggcagccctctcctcttcagcaccacgggcaattg
gctcagtctgggtcactcaatccggctatgggctatggacctcgtatgcagcaggcttcc
ggccagaaccagttcctctcccagactcagtttccatcccaaggaatgaatgtaacaaac
atgcctttggctccatccagcggtcaagcaccagtgtctcaagcacaaatgtccagttct
tcttgcccagtgaactctcctataatgcctccagggtctcaagggagccatattcactgt
ccttctctgcctcaacaagctcatcagaattcaccttctcctgttcctagccgaacccct
actcctcatcatacccccccaagcatagggactcaaccaccaccagcaacagcaattcca
gcacctgttcctacacctcccgccataccacctggaccacagcccccatctctgcatccc
tcatctagacaaacacctacaccaccaacacatctgcctcccccagtgcagccttcactt
cctgctgctccttctgctgaccagtcccagcaacagcctcgctcacagcagagcacagca
gcttctgttcctaccccaaccgcaccattgctgcctcctcagccttccactccgctttct
cagcctgctgtgagcattgaaggccaggtatcaaaccctccatctactagtagcacagaa
gtgaattctcagaatattcctgagaagcagccttcacaggaagtgaaaatggaggctaaa
atggaggtggatcaaccagaaccagcagatgctcaacctgatgatacaaaggagactaaa
gctgaggatgttaaagtagaacctacagaaatggaggagagaggctctgagttaaaaact
gaagtgaaagaggaagaagaccagccaaacacctctgctacccagtcctccccggctcct
ggacagtcgaagaagaagattttcaaaccagaagaattacgccaggctctgatgccaaca
ttggaggcactttaccggcaggacccagaatctcttccctttcgtcagcctgtggaccca
cagcttctaggaatccctttggagttttctccacagactctatgttgctatgggaaacag
ttatgcacaatcccccgtgatgctacttactacagttaccagaacaggtatcatttctgt
gagaagtgtttcaatgaaatccaaggggagagcgtttctttgggtgatgacccttcccaa
cctcaaactacaataaataaagaacaattttccaagagaaaaaatgacacactggatcct
gaactgtttgttgagtgcacagagtgtggaagaaagatgcaccagatctgtgtccttcac
cacgagatcatctggccatctgggtttgtctgtgatggctgtttaaagaaaactgcacga
actaggaaagaaaataagttttctgctaaaagattgccatctaccagacttgggaccttt
ctggagaatagagtgaatgactttctgaggcgacaaaatcaccccgaatcaggagaggtc
actgttcgggttgttcatgcttctgacaaaactgtggaagtgaaaccaggcatgaaagca
aggtttgtagatagtggagagatggcagaatcttttccttaccgaacaaaggccctgttt
gcctttgaagaaattgatggtgttgacttgtgtttctttggcatgcatgttcaagagtat
ggctctgactgcccccctcccaaccagaggagagtatacatatcttacctcgatagtgtt
catttcttccgtcctaaatgcttgcggactgcagtctatcatgaaattctaattggatat
ttggagtatgtcaagaaattaggatacacaacagggcacatctgggcctgtccacccagt
gaaggggatgactatatcttccattgccatccacctgatcagaagataccaaagcccaag
cgcctgcaagaatggtacaaaaagatgcttgacaaggctgtatcagaacgtattgtccat
gactacaaggatattttaaaacaagctactgaagatcgattgacaagtgcaaaggaacta
ccctactttgaaggtgatttctggcccaatgttctggaagaaagcatcaaggagcttgaa
caagaagaagaagagaggaaacgggaagagaacaccagcaacgagagtactgatgtaaca
aaaggagacagcaaaaatgctaagaagaagaataacaagaaaaccagcaaaaacaagagc
agcctgagtaggggtaataagaagaagcctggtatgcccaatgtgtctaatgacctttct
cagaaactatatgccaccatggaaaagcataaagaggtcttctttgtgatccgccttatc
gcttgtcctgctcccaattccctgcctcccattgttgatcctgaccctctcatcccctgt
gacctgatggatggtagagatgcattcctcacccttgcaagggacaagcacctggaattc
tcttcacttcgaagagcccagtggtctaccatgtgtatgctggtggagctccatacacag
agtcaggatcgctttgtctacacctgcaacgagtgcaagcaccacgtggagacacgctgg
cattgcactgtgtgtgaggattatgacctgtgcatcacctgttataacactaaaaatcat
gaccacaaaatggagaaactaggcctcggcttggatgatgaaagcaataaccagcaagct
gcagctacccagagcccaggagactcccgccgcctgagcatccagcgctgcatccaatct
ctggtgcatgcctgtcagtgccgcaatgccaactgttccctgccttcctgccagaagatg
aagagggttgtgcagcacaccaaaggctgcaaacggaaaaccaatggtggatgccccatt
tgcaaacagcttattgccctctgctgctatcacgccaagcactgccaggagaataagtgc
ccggtgccattctgcctcaacatcaagcaaaaactcaggcagcaacagctacagcaccgg
ctccaacaggctcagatgctccgcaggaggatggccagcatgcaacgaactggtgtggcg
gggcagcagcagggcctgccgtcccctactcctgctactccaactacccctactggccaa
cagccagccaccccacagacaccccagccccagcccacctctcaaccacagcccactcct
cccaacaacatgacaccctacttacccaggactcagactactggccctgtgtcccagggt
aaggcagcagggcaagtgaccccaccaaccccacctcagactgctcaggccccccttcca
gggcctccacctgcagcagtagaaatggcaatgcaaattcagagggcagcagagacacag
cgccagatggcccatgtacagattttccaaaggccaatccagcaccagatgccccagatg
gcacccatggcccctatgggcatgaacccacctcctatggccagaggtcctggtgggcat
ttggatccaggaataggtcccacaggaatgcagcaacagccgccttgggcccaaggagga
atgcctcagccccagcagatgcagtcagggatgccaaggccagccatgatgtcagtggca
cagcatggtcagcctttgaacatggctccacaaccaggattgggccaagtgggtgtgagc
cctctcaagccaggcactgtgtctcaacaagccttacaaaaccttttgcggactctcagg
tctcccagttctcccttacagcagcaacaggtgcttagtatccttcatgccaacccccaa
ctgttggctgcattcatcaagcagcgggctgccaagtatgccaaccctaatccacagcct
ctccctggacagcctggcatgccccagggacagccagggctgcagccacctaccatgcct
ggccagcaaggtgtccactccaacccagccttgcagaacatgaatcctctgcaggcaggt
gtccagagagctggcctgccccagcagcagccgcagcagcagcagctccaaccacccatg
ggagccatgagtccccaagctcagcaaatgaacatgaatcacaataccatgccttcacag
ttcagagacatcttaagacggcagatgatgcaacagcagggagcagggccaggaatcggc
cctggaatggccaaccacaaccagttccagcagccccaaggaattggctatccaccccag
cagcagcagcagcagcagcgaatgcagcatcacatgcagcaaatgcagcaaggaaatatg
ggacaaatgggtcagcttccccaggctctgggggctgaggcaggagccagtctacaggcc
tatcagcagcgacttcttcaacaacaaatgggatctcctgctcagcccaaccctatgagc
ccacagcagcacatgctcccaaatcaggcacagtccccacacctacaaggtcaacaaatc
cctaattctctctccaatcaagtgcgctctccccagcctgtcccttctcctcgaccacag
tctcagcccccccattccagcccatctccgaggatgcagcctcagccttctccacaccat
gtttctccacagaccagttccccacatcctggactggtagctgcccaggctgccaacccc
atggaacaagggcattttgccagcccagaccagaattcaatgctttcacagctcgctagc
aatccaggcatggcaaacctccatggggcaagtgccacggacctgggactgagcagcgat
aatgcagacttgaattcaaacctctcacagagtacactagacatacactag

DBGET integrated database retrieval system