KEGG   Mus pahari (shrew mouse): 110330198
Entry
110330198         CDS       T05929                                 

Gene name
Nf2
Definition
(RefSeq) merlin isoform X1
  KO
K16684  merlin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
mpah04392  Hippo signaling pathway - multiple species
mpah04530  Tight junction
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110330198 (Nf2)
   04392 Hippo signaling pathway - multiple species
    110330198 (Nf2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110330198 (Nf2)
SSDB
Motif
Pfam: ERM FERM_C FERM_M FERM_N
Other DBs
NCBI-GeneID: 110330198
NCBI-ProteinID: XP_021065820
Ensembl: MGP_PahariEiJ_G0016851
LinkDB
Position
13
AA seq 616 aa
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETW
FFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFL
QVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMT
PEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFTIRNKKGTELLLGVDALG
LHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLC
IGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAERTRDELERRL
LQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRTE
EEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDLQEAREAERRAKQKLLEIATKPT
YPPVNPIPPPLPPDIPSFDIVGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLN
ELKTEIEALKLRERETALDILHTENSDRGGTSSKHSTIKKSSPRQKTYLHLSPQSRLFPG
ILSVVLVLPSVVLTRA
NT seq 1851 nt   +upstreamnt  +downstreamnt
atggccggagccatcgcttcccgcatgagcttcagctcactcaagaggaagcagcccaag
acattcacggtgcggatcgtcaccatggacgccgagatggagttcaactgcgagatgaaa
tggaaggggaaggacctgtttgatttggtgtgccggacgctggggcttcgggaaacctgg
ttctttggattgcagtatacaatcaaggacacggtggcctggctcaaaatggacaagaag
gtgttggatcatgatgtttcgaaggaagaacccgttacctttcacttcctggccaaattt
tatcctgaaaatgctgaggaggagctagttcaagagatcacgcaacacttatttttctta
caggtgaagaagcagattttggatgaaaaggtctactgccctcccgaggcgtccgtgctc
ttggcgtcatatgctgtccaggccaagtatggcgactatgacccctctgtgcacaagcgg
ggttttttagcccaagaggaattgcttccgaaaagggtgataaatctctatcagatgact
ccggaaatgtgggaggagagaattactgcttggtatgcggagcaccggggcagagccagg
gatgaagctgaaatggagtatttgaagatagctcaggacctggagatgtatggtgtgaac
tactttacaatccggaataaaaagggcacggagctgctgcttggagtggacgctctcggg
cttcatatctatgaccccgagaacaggctgacccccaagatctccttcccatggaatgaa
atccgaaacatctcctacagcgacaaggagtttactattaaaccactggataagaaaatt
gatgtcttcaaatttaactcttcaaagcttcgtgttaataagctgattcttcagctatgt
attgggaaccatgacctatttatgaggagacggaaagctgactctttagaagttcagcag
atgaaagcccaggccagagaagagaaggctagaaagcagatggagaggcagcggctggct
cgagagaagcagatgcgggaggaggccgagcgtacgagagacgagttagagaggcggctc
ctgcagatgaaagaagaagcaacgatggccaatgaagctctgatgcgctctgaggagaca
gctgatctgttggctgaaaaggctcagatcacagaggaggaggctaagcttctggcacaa
aaggctgcagaggctgagcaagagatgcagcgaatcaaggccacagccatccggacagag
gaagagaagcgcctgatggagcagaaggtgctggaggctgaagtgctggcattgaagatg
gctgaggagtcagagaggagggccaaggaggctgatcagttaaagcaagacttgcaagaa
gcccgagaagcagagcgaagagctaagcagaagctcttagaaatcgccaccaagcctacc
tatccacccgtgaacccaatcccaccaccactgcctcctgacataccgagcttcgacatt
gttggtgacagcttgtcattcgacttcaaggatacggacatgaagcgactttccatggag
atagagaaagaaaaagtagagtacatggagaagagcaagcacctgcaagagcagctcaac
gagctcaagacggagattgaggccctgaaactcagagagagggagacagccttggacatc
ctgcacaccgagaactcagacagaggcggcaccagcagcaagcatagtaccattaaaaag
tcaagcccaaggcagaagacctatctgcatttgagtcctcaaagtaggttattcccaggt
attctgtctgtggtgctggtccttccgtctgtggtactaacccgtgcatga

DBGET integrated database retrieval system