KEGG   Mus pahari (shrew mouse): 110330230
Entry
110330230         CDS       T05929                                 

Gene name
Kit
Definition
(RefSeq) mast/stem cell growth factor receptor Kit isoform X1
  KO
K05091  proto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04640  Hematopoietic cell lineage
mpah04916  Melanogenesis
mpah05200  Pathways in cancer
mpah05221  Acute myeloid leukemia
mpah05224  Breast cancer
mpah05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110330230 (Kit)
   04014 Ras signaling pathway
    110330230 (Kit)
   04015 Rap1 signaling pathway
    110330230 (Kit)
   04072 Phospholipase D signaling pathway
    110330230 (Kit)
   04151 PI3K-Akt signaling pathway
    110330230 (Kit)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110330230 (Kit)
  09152 Endocrine system
   04916 Melanogenesis
    110330230 (Kit)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110330230 (Kit)
   05230 Central carbon metabolism in cancer
    110330230 (Kit)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    110330230 (Kit)
   05224 Breast cancer
    110330230 (Kit)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110330230 (Kit)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110330230 (Kit)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110330230 (Kit)
Protein kinases [BR:mpah01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   110330230 (Kit)
CD molecules [BR:mpah04090]
 Proteins
  110330230 (Kit)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Ig_5 Ig_4 Ig_6 V-set UPF0220 APH Pkinase_fungal DUF2039 C1-set
Other DBs
NCBI-GeneID: 110330230
NCBI-ProteinID: XP_021065876
Ensembl: MGP_PahariEiJ_G0017090
LinkDB
Position
13
AA seq 978 aa
MRGARGAWDLLCILLVLLRGQTATSQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCVD
PNFVKWTFETVNEMVENKHNEWVQEKAEAARTGKYTCTNSNGLTSSIYVFVRDPAKLFLV
GLPLFGKEDSDALVRCPLTDPQVSNYSLMECDGKALPTDLTFVPNPKAGITIKNVKRAYH
RLCVRCAAQREGTWLHSDKFILKVRAAIKAIPVVSVPETSYLLKKGDTFTVVCTIKDVST
SVGSMWLKMNPQPQSIAQVKRNSWHRGDFNYERQETLTINSARVNDSGVFMCYANNTFGS
ANVTTTLKVVEKGFINIFPVKNTTVFVTDGENVDLVVEYEAYPKPEHQQWIYMNRTSTNK
GKDYVKSDNNSNIRYVNQLGLTRLKGTEGGTYTFLVSNSDVSASVTFSVYVNTKPEILTY
DRLMNGMLQCVAEGFPEPTIDWYFCTGAEQRCTVPVSPVDVQVQNVSVSPFGKLVVQSSI
DSSVFRHNGTVECKASNYVGKSSAFFNFAFKGNNKEQIQAHTLFTPLLIGFVVAAGAMGI
VVMVLTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAG
AFGKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLG
ACTVGGPTLVITEYCCYGDLLNFLRRKRDSFIFSKQEEQAEVALYKNLLNSKEPPCDSSN
EYMDMKPGVSYVVPTKTDKRRSARIDSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKG
MAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIRNDSNYVVKGNARLPVKWMAPE
SIFSCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMESPEHAPAEM
YDVMKTCWDADPLKRPTFKQVVQLIEKQISDSTKHIYSNLANCNPNPENPVVVDHSVRVN
SVGSSASSTQPLLVHEDA
NT seq 2937 nt   +upstreamnt  +downstreamnt
atgagaggcgctcgcggcgcctgggatctgctctgcatcctgttggtcctgctccgtggc
cagacagccacgtctcagccatctgcgagtccaggggagccgtctccgccatccatccat
ccagcgcaatcagagttaatagttgaagctggcgacaccctcagcctgacgtgcgttgac
cccaacttcgtcaaatggactttcgagaccgtcaatgaaatggttgagaataaacacaat
gaatgggtccaggaaaaagccgaggctgctcgcacgggcaaatacacgtgcaccaatagc
aatggcctcacgagttctatttacgtgtttgttagagatcctgccaaacttttcctggtt
ggccttcccttgtttggcaaagaagacagcgacgcgctggtccgatgccctctgacagac
ccacaggtgtccaattattccctcatggagtgtgatgggaaagctctccccacggaccta
acgtttgtcccaaaccccaaggctggcatcaccatcaaaaacgtgaagcgcgcctaccac
cggctgtgtgtccgctgtgctgcccagcgtgagggcacatggctgcattctgacaaattc
atcctcaaagtgcgggcagccatcaaggctatccctgtcgtgtctgttcctgaaacaagt
tacctccttaagaaaggggacacatttacggtggtatgcaccataaaagatgtgtctacg
tctgtgggctccatgtggctaaagatgaaccctcagcctcagagcatagcccaggtaaag
cgcaatagctggcatcggggtgacttcaattacgaacgccaggagacgttgactatcaac
tcagcaagagttaacgattctggagtgttcatgtgttatgccaataatacttttggatca
gcaaatgtcacaacaaccttgaaagtagtagaaaaaggattcatcaacatcttccctgtg
aagaacactacagtatttgtaaccgatggagaaaatgtagacttggttgttgaatacgag
gcctaccctaaacccgagcaccagcagtggatatatatgaacaggacctctactaacaaa
gggaaggattacgtcaaatctgataacaatagtaacatcagatatgtgaaccaacttggc
ctgacgagattgaaaggcacagaaggaggcacttacacctttctggtctccaactctgat
gtcagtgcttccgtgacattcagcgtttatgtgaacacaaaaccagaaatcctcacgtac
gacaggctcatgaacggcatgctccagtgtgtggcggagggattcccggagcccacaata
gattggtatttttgtacaggggcagagcaaaggtgtaccgttcctgtctcaccagtggac
gtacaggtccagaacgtatctgtgtcaccatttggaaaactggtggttcagagttctata
gactccagcgtcttccggcacaatggcacggtggagtgtaaggcctccaactatgtgggc
aagagttccgccttctttaactttgcatttaaaggtaacaacaaagagcaaatccaggcc
cacaccctgttcacgccgctgctcattggctttgtggtcgcagctggcgcgatggggatc
gttgtgatggtcctcacctacaaatatttgcagaaacccatgtatgaagtacaatggaag
gttgtcgaggagataaatggaaacaattatgtttacatagacccaacgcaacttccttat
gatcacaaatgggagtttcccagaaacaggctgagttttggaaagacactgggagctggt
gccttcgggaaggtcgttgaagccactgcgtacggtttgattaagtcagatgctgccatg
acggttgccgtgaagatgctcaaaccaagtgcccatttgacagaaagggaggccttaatg
tcggaactgaaggtcctgagctacctgggcaatcacatgaatattgtgaacctccttgga
gcatgcaccgtgggagggcctaccctggtcattacagaatattgttgctatggtgatctt
ttgaattttttgagacgaaaacgtgattcgtttattttctcaaagcaagaagaacaggca
gaagtggcactttataagaaccttctgaactcaaaggagcccccctgtgacagttcaaat
gagtacatggacatgaagcctggcgtttcctacgtcgtgccaaccaagacagacaagagg
agatccgcaagaatagactcgtacatagagagagacgtgactcctgccatcatggaggat
gacgagctggctctcgacctggaagatttgctgagcttctcctaccaggtggccaagggc
atggcgttcctcgcctccaagaattgtattcacagagatttggcagccaggaatatcctc
ctcactcacgggcggatcacaaagatttgcgatttcggtctagccagagacattaggaat
gattcgaattacgtggtcaaaggcaacgcacgactccccgtgaagtggatggcaccggag
agcattttcagctgcgtgtacacgtttgaaagtgatgtctggtcctatgggattttcctc
tgggagctcttctccttagggagcagcccctatccagggatgcccgtcgactccaagttt
tacaagatgatcaaggaaggcttccggatggaaagcccagagcacgcgcctgctgaaatg
tatgacgtcatgaagacttgctgggacgctgaccccttgaaaaggccaacattcaagcag
gttgtccaactcattgagaagcagatctcagacagcaccaagcacatttactccaacttg
gcaaactgcaaccccaacccagagaaccccgtggtggtggaccattccgtgagggtcaac
tcagttggcagcagcgcctcttctacgcagcctctgctcgtgcacgaagatgcctga

DBGET integrated database retrieval system