KEGG   Mus pahari (shrew mouse): 110330480
Entry
110330480         CDS       T05929                                 

Gene name
Egfr
Definition
(RefSeq) epidermal growth factor receptor isoform X1
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04020  Calcium signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04068  FoxO signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04144  Endocytosis
mpah04151  PI3K-Akt signaling pathway
mpah04510  Focal adhesion
mpah04520  Adherens junction
mpah04540  Gap junction
mpah04630  JAK-STAT signaling pathway
mpah04810  Regulation of actin cytoskeleton
mpah04912  GnRH signaling pathway
mpah04915  Estrogen signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04926  Relaxin signaling pathway
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04934  Cushing syndrome
mpah05160  Hepatitis C
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05210  Colorectal cancer
mpah05212  Pancreatic cancer
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05218  Melanoma
mpah05219  Bladder cancer
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05230  Central carbon metabolism in cancer
mpah05231  Choline metabolism in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110330480 (Egfr)
   04012 ErbB signaling pathway
    110330480 (Egfr)
   04014 Ras signaling pathway
    110330480 (Egfr)
   04015 Rap1 signaling pathway
    110330480 (Egfr)
   04630 JAK-STAT signaling pathway
    110330480 (Egfr)
   04066 HIF-1 signaling pathway
    110330480 (Egfr)
   04068 FoxO signaling pathway
    110330480 (Egfr)
   04020 Calcium signaling pathway
    110330480 (Egfr)
   04072 Phospholipase D signaling pathway
    110330480 (Egfr)
   04151 PI3K-Akt signaling pathway
    110330480 (Egfr)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110330480 (Egfr)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110330480 (Egfr)
   04520 Adherens junction
    110330480 (Egfr)
   04540 Gap junction
    110330480 (Egfr)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110330480 (Egfr)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    110330480 (Egfr)
   04915 Estrogen signaling pathway
    110330480 (Egfr)
   04921 Oxytocin signaling pathway
    110330480 (Egfr)
   04926 Relaxin signaling pathway
    110330480 (Egfr)
   04928 Parathyroid hormone synthesis, secretion and action
    110330480 (Egfr)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110330480 (Egfr)
   05206 MicroRNAs in cancer
    110330480 (Egfr)
   05205 Proteoglycans in cancer
    110330480 (Egfr)
   05230 Central carbon metabolism in cancer
    110330480 (Egfr)
   05231 Choline metabolism in cancer
    110330480 (Egfr)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110330480 (Egfr)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110330480 (Egfr)
   05212 Pancreatic cancer
    110330480 (Egfr)
   05225 Hepatocellular carcinoma
    110330480 (Egfr)
   05226 Gastric cancer
    110330480 (Egfr)
   05214 Glioma
    110330480 (Egfr)
   05218 Melanoma
    110330480 (Egfr)
   05219 Bladder cancer
    110330480 (Egfr)
   05215 Prostate cancer
    110330480 (Egfr)
   05213 Endometrial cancer
    110330480 (Egfr)
   05224 Breast cancer
    110330480 (Egfr)
   05223 Non-small cell lung cancer
    110330480 (Egfr)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110330480 (Egfr)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110330480 (Egfr)
   05171 Coronavirus disease - COVID-19
    110330480 (Egfr)
   05163 Human cytomegalovirus infection
    110330480 (Egfr)
   05165 Human papillomavirus infection
    110330480 (Egfr)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110330480 (Egfr)
   01522 Endocrine resistance
    110330480 (Egfr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110330480 (Egfr)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110330480 (Egfr)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110330480 (Egfr)
Protein kinases [BR:mpah01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   110330480 (Egfr)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   110330480 (Egfr)
  Exosomal proteins of pancreatic cancer cells
   110330480 (Egfr)
  Exosomal proteins of bladder cancer cells
   110330480 (Egfr)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like
Other DBs
NCBI-GeneID: 110330480
NCBI-ProteinID: XP_021066267
Ensembl: MGP_PahariEiJ_G0016788
LinkDB
Position
13
AA seq 1210 aa
MRPSGTTRTTLLVLLTALCAAGGALEEKKVCQGTSNRLTQLGTFEDHFLSLQRMYNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNALYENTYALA
ILSNYGTNRTGLRELPMRNLQEILIGAVRFSNNPILCNMETIQWRDIVQNVFLSNMSMDL
QSHPSSCPKCDPSCPNGSCWGGGEENCQKLTKIICAQQCSRRCRGRSPSDCCHNQCAAGC
TGPRESDCLVCQKFRDEATCKDTCPPLMLYNPTTYQMDINPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACGPDYYEVEEDGLRKCKKCDGPCRKVCNGIGIGEFKDTLSINATNIKHFK
YCTAISGDIHILPVAFKGDSFTRTPPLDPRELEILKTVKEITGFLLIQAWPENWTDLHAF
ENLEIIRGRTKQHGQFSLAVVGLNITTLGLRSLKEISDGDVIISANRNLCYANTINWKKL
FGTPNQKTKIVSNRAEKDCKAMNHVCNPLCSSEGCWGPEPRDCVSCQNVSRGRECVDKCN
ILEGEPREFVENSECIQCHPECLPQTMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGIM
GENNTLVWKYADANNVCHLCHVNCTYGCSGPGLQGCEVWPSGPKIPSIATGIVGGLLFIV
VVALGIGLFIRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQAHLRILKETEFKKIKVL
GSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLL
GICLTSTVQLITQLMPYGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDL
AARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVW
SYGVTVWELMTFGSKPYDGIPASDISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSR
PKFRELILEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMEDVVDADEYLI
PQQGFFNSPSTSRTPLLSSLSATSNNSTVACINRNGSCRVKEDTFLQRYSSDPTGVVTED
NIDDAFLPAPEYINQSVPKRPAGSVQNPVYHNQPLHPAPGRDLHYQNPHSNAVGNPEYLN
TAQPTCLSSGFNSPAFWIQKDSHQMNLDNPDYQQDFSPKEAKPNGIFKGPTAENAEYLRV
APPSSEFIGA
NT seq 3633 nt   +upstreamnt  +downstreamnt
atgcgaccctcggggaccacgagaaccacgttgctggtgctgctgaccgcgctctgcgcc
gcaggtggggcgctggaggaaaagaaagtctgccaaggcacaagtaacaggctcacccaa
ctgggcacttttgaagaccactttctgagcctgcagaggatgtacaacaactgtgaagtg
gtccttgggaacttggaaattacctatgtgcaaaggaattatgacctttccttcttaaag
accatccaggaggtggctggctatgtcctcatcgccctcaacaccgtggagagaatccct
ttggagaacctgcagatcatcaggggaaatgctctctatgaaaacacctatgccttagcc
atcctgtccaactacgggacaaacagaactgggcttagggaactgcccatgcggaactta
caggaaatcctgattggtgctgtgcgattcagcaacaaccccatcctctgcaatatggag
actatccagtggagggacatcgtccaaaatgtctttctgagcaacatgtcaatggactta
cagagccacccgagcagttgccccaaatgtgatccaagctgtcccaatggaagctgctgg
ggcggaggagaagagaactgccagaaattgaccaaaatcatctgtgcccagcaatgttcc
cggcgttgtcgtggcaggtcccccagtgactgctgccacaaccagtgtgccgcggggtgt
acgggaccccgagagagtgactgtctggtctgccaaaagttccgagatgaggccacatgc
aaagacacctgcccaccactcatgctgtacaaccctaccacatatcagatggatatcaac
cctgaagggaagtacagctttggtgccacctgtgtgaagaagtgtccccgaaactatgtg
gtgacagatcatggctcatgtgtccgggcctgtgggcctgactactacgaagtggaagaa
gatggcctccgaaagtgtaaaaaatgtgatgggccctgtcgcaaagtttgtaatggcata
ggcattggtgaatttaaagacacgctctccataaatgctacaaatatcaaacacttcaaa
tactgcactgccatcagcggggacattcacatcctgccagtggcctttaagggggattct
ttcacgcgcactcctcctctagacccacgagaactagaaatcctaaaaaccgtaaaggaa
ataacagggtttttgctgattcaggcttggcctgaaaactggactgacctccatgctttt
gagaacctagaaattatacgtggcagaacaaagcaacatggtcagttttctctggcggtt
gtcggcctgaacatcacaacactggggttgcgttccctcaaggagatcagtgatggggat
gtgatcatttctgcaaaccgaaatttgtgctacgcaaacacaataaactggaaaaaactc
ttcgggacacccaatcagaaaaccaaaatcgtgagcaacagagctgagaaagactgcaag
gccatgaaccacgtctgcaatcctttatgctcctccgaaggctgctggggccctgagccg
agggactgtgtctcctgccagaatgtgagcagaggcagggagtgcgtggataaatgcaac
atcctggagggggagccgagggagtttgtggaaaattcggaatgcatccagtgccatcca
gaatgtctgccccagaccatgaacatcacctgtacaggcagggggccagacaactgcatc
cagtgtgcccactatattgatggcccacactgtgtcaagacctgcccagctggcatcatg
ggggagaacaacaccctggtctggaagtatgcagatgccaataatgtctgccacctctgc
catgtcaactgtacctatggatgttctgggccaggtcttcaaggatgtgaagtatggcca
tctgggccaaagatcccatctatcgccactgggattgtgggtggcctcctcttcatagtg
gtggtggcccttgggattggcctattcatccgaaggcgtcacattgtccgaaagcgtaca
ctacgccgcctgcttcaagagagagagctcgtggaacctctcacacccagcggagaagct
ccaaaccaagcccacttgaggatattaaaggaaacagaattcaaaaagatcaaagttctg
ggttcaggagcatttggcacagtgtataagggtctctggatcccagaaggtgagaaagta
aaaatcccggtggccatcaaggagttaagagaagccacatctccaaaagccaacaaggaa
atccttgacgaagcctatgtgatggctagtgtggacaaccctcatgtgtgccgcctcctg
ggcatctgtctgacctccaccgtccagctcatcacacagctcatgccctatggttgcctc
ctggactatgtccgagaacacaaggacaacattggctcccagtacctactcaactggtgt
gtgcagattgcaaagggcatgaactacctggaagatcggcgtttggtgcaccgtgacttg
gcagccaggaatgtactggtgaagacaccacagcatgtcaagatcacagattttgggctg
gccaaactgctcggtgctgaagagaaagaatatcacgcagaggggggcaaagtgcctatc
aagtggatggctttggaatcaattttacaccgaatttatacacaccaaagcgatgtctgg
agttatggagtcaccgtgtgggaactgatgacctttgggtccaagccttatgatggaatc
cccgcaagtgacatctcatccatcctagagaaaggagagcgccttccacagccacctatc
tgcaccattgatgtctacatgatcatggtcaagtgctggatgatagatgctgatagccgc
ccaaagttccgcgagttgattcttgaattctccaaaatggcccgagacccacaacgctac
cttgttatccagggggatgaaagaatgcatttgccaagcccgacagactccaacttttac
cgagccctgatggatgaagaggacatggaggatgtagttgatgctgatgagtatcttatc
ccacagcaaggcttcttcaacagcccatccacatcgaggactcccctcttgagttctctg
agtgcaactagcaacaattccacagtggcttgcattaatagaaatgggagctgccgtgtc
aaagaagacaccttcttgcagcggtacagctccgaccccacaggcgttgtaacagaggac
aacatagatgacgcattcctccctgcacctgaatatataaaccaatctgttcccaagagg
ccagcaggctctgtacagaaccccgtctatcacaatcagcccctgcatccagctcctgga
agagacctgcattatcaaaatccccatagcaatgcagtgggcaaccctgagtatctcaac
actgcccagcctacctgtctcagtagtgggtttaacagccctgcattctggatccagaaa
gacagccaccaaatgaacctagacaaccctgactaccagcaggacttctcccccaaggaa
gccaagccaaatggcatctttaagggccccacagcggaaaatgcagagtacctacgggtg
gcacctccaagcagcgagtttattggagcatga

DBGET integrated database retrieval system