KEGG   Mus pahari (shrew mouse): 110330740Help
Entry
110330740         CDS       T05929                                 

Gene name
Lhpp
Definition
(RefSeq) phospholysine phosphohistidine inorganic pyrophosphate phosphatase isoform X1
  KO
K11725  phospholysine phosphohistidine inorganic pyrophosphate phosphatase [EC:3.6.1.1 3.1.3.-]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00190  Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    110330740 (Lhpp)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110330740 (Lhpp)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-  
     110330740 (Lhpp)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.1  inorganic diphosphatase
     110330740 (Lhpp)
Protein phosphatases and associated proteins [BR:mpah01009]
 HAD phosphatases
  Other HAD phosphatases
   110330740 (Lhpp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_like Hydrolase_6 Hydrolase HAD_2 Nuf2 Nif11
Motif
Other DBs
NCBI-GeneID: 110330740
NCBI-ProteinID: XP_021066692
Ensembl: MGP_PahariEiJ_G0013786
LinkDB All DBs
Position
1
AA seq 270 aa AA seqDB search
MAAWAERLKGVRGVLLDISGVLCDSSASGATAIAGSVEAVARLKRSPLKVRLCTNESQKS
LRELVGLLQQLGFDISEEEVTAPAPATCKILKERGLRPHLLIHEGVRSEFDDIDMSNPNC
VVIADAGEAFSYQNMNRAFQVLMELENPVLISLGKGRYYKETSGLMLDVGGYMKALEYAC
GIKAEVVGKPSPEFFKSALQAIGVEAHQAIMIGDDIVGDVGGAQQCGIRALQVRTGKFRP
GDEHHPEVKADGYVDNLAEAVDLLLKYMDK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggccgcatgggctgaacggctgaagggcgtgcggggggtgctgcttgacatctccggc
gtgctgtgtgacagcagcgcaagcggtgcaaccgctatcgcaggctctgtggaggcggtg
gcgagactgaaacggtccccactgaaagtgagactctgtaccaatgagtctcagaaatcc
ttgagagagctggtggggctgcttcagcagctggggtttgacatctcagaagaagaggtg
actgcccctgcaccagccacctgcaagatcctgaaggagcgaggcctgcggccacacttg
cttatccatgaaggagtccgctcagaatttgatgacatcgatatgtccaacccaaactgt
gtggtgattgcggatgccggggaggccttttcctatcagaacatgaacagagccttccaa
gtgctaatggagctggaaaaccccgtgctcatatccctgggaaaaggacgctattacaag
gagacctctggcctgatgctggacgttggaggttacatgaaggcgctcgagtatgcctgt
ggtatcaaggctgaagtggtggggaaaccctcccctgagttcttcaagtctgctctacaa
gccataggggtggaagcccaccaggccatcatgattggcgatgacatcgtgggtgacgtt
ggtggtgcccagcagtgtggaataagagctctgcaggtgcggaccgggaagttcagacct
ggtgatgagcatcatccagaagtaaaggcagatgggtacgtggacaaccttgcggaggcc
gtggatctgctgctgaagtacatggacaagtga

DBGET integrated database retrieval system