KEGG   Mus pahari (shrew mouse): 110330820
Entry
110330820         CDS       T05929                                 

Gene name
Rassf6
Definition
(RefSeq) ras association domain-containing protein 6 isoform X1
  KO
K09854  Ras association domain-containing protein 6
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
mpah04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110330820 (Rassf6)
   04392 Hippo signaling pathway - multiple species
    110330820 (Rassf6)
SSDB
Motif
Pfam: RA Nore1-SARAH Ras_bdg_2
Other DBs
NCBI-GeneID: 110330820
NCBI-ProteinID: XP_021066796
Ensembl: MGP_PahariEiJ_G0017169
LinkDB
Position
13
AA seq 341 aa
MTAMDHQFPSWIVVDESTSISREQLNYLLETYNVFYENQKNLHILYGQTEDGQLIVEGML
DIFWGVKRPIQLKIQDEKQISSFDLLNSPETFASKGRMTRWGEFDDLYRISELDRTRVLA
SEARHSPEDYLSYHSTLTPYADEEPESPLLYRTMSEAALVRKRMRAPEMYRKDRMGVLSH
HRASINGHVYNHETSIFTPTFGSETKVRANSVMRTEEVIKQLLQKFKIENSPRDFALYII
FGTGEQRKLKKTDVPLLQRLLQGPSKSNARIFLMDKDAEEISRDVAPYINFHFSFLESIL
QRLDEEEKMETERIMAKFNTERAFILKCLQNKQAVKTETTV
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgacagcgatggatcaccagttcccttcttggatcgttgtcgatgagagcacatccata
agcagggaacaacttaattatttactggagacttataatgttttctatgaaaaccagaaa
aatctgcatatattgtatgggcagaccgaagacggacagctgattgttgaagggatgctg
gacattttctggggagtcaaacgacccatacagctgaaaatacaagatgagaagcaaatc
tcttcctttgatctgttgaactcaccggaaacctttgccagcaaagggaggatgactcgc
tggggagaatttgatgacctttaccgtatcagtgagctggacaggacccgcgttctagca
tctgaggccaggcattccccggaagactatttatcttaccacagcactctgacgccatac
gcagacgaagagccggaatccccgttgctctacaggaccatgagtgaggcagctttggtg
agaaaaaggatgagggccccagagatgtacagaaaagatagaatgggggtgctaagtcac
cacagagcctctatcaatggacacgtctacaaccatgagacatccatcttcaccccaact
ttcgggtcagagactaaggtcagagccaatagtgtcatgagaactgaagaagtaataaag
caacttctccagaaatttaagattgaaaatagccctcgggatttcgctctttacattatt
tttgggacaggagagcagagaaagctaaagaagaccgatgtcccactgctgcagaggcta
ctacaaggaccatccaaaagcaacgctcggatcttcctcatggataaagatgcagaagaa
atcagcagagatgtggctccgtacattaattttcacttttctttcttggaatccattctt
caaagattagatgaagaagagaaaatggagactgagagaattatggcaaaattcaatacc
gaaagggcctttatcctgaagtgtctacagaataagcaggcagtgaaaacggagaccaca
gtctag

DBGET integrated database retrieval system