KEGG   Mus pahari (shrew mouse): 110330883
Entry
110330883         CDS       T05929                                 

Definition
(RefSeq) whey acidic protein-like
  KO
K17106  whey acidic protein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    110330883
SSDB
Motif
Pfam: WAP Dickkopf_N
Other DBs
NCBI-GeneID: 110330883
NCBI-ProteinID: XP_021066844
LinkDB
Position
13
AA seq 211 aa
MRCFISLVLGLLALEVALARNLQDQVFNSVPSMFPDGSPIVGTECVNCQTNEECARNAMC
CPNSCGKSCKTPVNTKSPPIGVTKAGICPWDLLQTITAGPCPKKISCSSDSQCPGNMKCC
IKDCIMTCVDPVPGMQLQDPGPPLLPRPLAPTLPYIRSKSRYSNSPSPFRLCFPRPGSRY
ASQSRKPELSKDGDGRDRAEGVASVLQPSVP
NT seq 636 nt   +upstreamnt  +downstreamnt
atgcgttgcttcatcagcctcgttcttggcctgctggccctggaggtggccctcgctcgg
aacctacaggatcaagtcttcaactcagttccgtccatgttccctgatggcagccccatt
gtgggcacagagtgtgtcaactgtcaaaccaacgaggagtgtgcccggaatgctatgtgc
tgtcccaattcctgtggtaagagctgcaaaactcctgtcaatactaagtccccgcccatt
ggtgttacaaaagctggcatctgcccctgggatctactccaaacgatcactgccgggcca
tgcccaaagaagatatcttgctccagcgacagtcagtgtcctggcaacatgaaatgttgc
atcaaggactgtatcatgacatgtgtggacccagtgccaggtatgcagcttcaagaccct
ggacccccacttctccctagacctctggcccccaccctaccctacatcagatccaagagc
agatacagtaattcaccctctcctttccgtctctgtttcccacgaccaggatctcgctac
gcttcccagtcccggaagcctgagctcagcaaggatggcgacggccgggaccgggcggag
ggcgtggcctccgtcctgcagccctcggtcccctag

DBGET integrated database retrieval system