KEGG   Mus pahari (shrew mouse): 110330966
Entry
110330966         CDS       T05929                                 

Gene name
Areg
Definition
(RefSeq) amphiregulin
  KO
K09782  amphiregulin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04390  Hippo signaling pathway
mpah05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110330966 (Areg)
   04012 ErbB signaling pathway
    110330966 (Areg)
   04390 Hippo signaling pathway
    110330966 (Areg)
   04151 PI3K-Akt signaling pathway
    110330966 (Areg)
 09160 Human Diseases
  09162 Cancer: specific types
   05210 Colorectal cancer
    110330966 (Areg)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mpah03110]
    110330966 (Areg)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110330966 (Areg)
Chaperones and folding catalysts [BR:mpah03110]
 Intramolecular chaperones
  Others
   110330966 (Areg)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110330966 (Areg)
SSDB
Motif
Pfam: FtsL Rieske CRIM1_C YiaAB EGF
Other DBs
NCBI-GeneID: 110330966
NCBI-ProteinID: XP_021066938
Ensembl: MGP_PahariEiJ_G0017180
LinkDB
Position
13
AA seq 246 aa
MRTPLLPLALSVLSLLVLGSGHYAAALELNDPSSEKGESLSGDHGADGLAVSVGREVSTI
SEMPSGSELSTGDYDYSEEYDNEPQISSYIVDDSVRVEQVIKPKKNKTEGEKSTEKPKRK
KKGGKSGKGRRNKRKKNPCTAKFQNFCIHGECKYIENLEVVTCNCHQDYFGERCGEKSMK
THSEDDKDLSKIAVVAVTIFVSAVLLIAIGIVITVHLWKRYFRGYEGEAEERRRLRQENG
NVLVTA
NT seq 741 nt   +upstreamnt  +downstreamnt
atgagaactccgctgctaccgctggcgctctcagtgctgtcgctgctggtcttaggctca
ggccattatgcagctgccttggagctcaatgaccccagctccgagaaaggcgaatcactt
tctggggaccacggtgccgatggacttgcggtttctgtgggaagagaggtctccaccata
agcgaaatgccttctggcagtgaactctccacaggggactatgactactcagaggaatac
gataatgaaccacaaatatccagctatattgtagatgattcagtcagagttgaacaggtg
attaaacccaagaaaaacaagacagagggagaaaagtctacagaaaaacccaaaagaaag
aaaaagggaggcaaaagtggaaaaggcagacgaaataagaggaagaagaatccatgcact
gccaagtttcagaacttttgcattcatggtgaatgcaaatacatcgagaacctggaggtg
gtgacatgcaattgtcatcaagattactttggtgaacggtgtggagaaaaatccatgaag
actcacagcgaggacgataaggacctatccaagattgcagtagtggccgtcactatcttt
gtctctgccgtcctcctcatagctattggcatcgttatcacagtgcacctttggaaacga
tacttcaggggatatgaaggagaagcagaagaaagaaggaggcttcgacaagaaaatggg
aatgtccttgtcactgcctag

DBGET integrated database retrieval system