KEGG   Mus pahari (shrew mouse): 110331008
Entry
110331008         CDS       T05929                                 

Gene name
Afp
Definition
(RefSeq) alpha-fetoprotein
  KO
K16144  alpha-fetoprotein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110331008 (Afp)
SSDB
Motif
Pfam: Serum_albumin VitD-bind_III VTC
Other DBs
NCBI-GeneID: 110331008
NCBI-ProteinID: XP_021066983
Ensembl: MGP_PahariEiJ_G0017166
LinkDB
Position
13
AA seq 611 aa
MKQPAAMKWSIPASLILLLHFAGSIARHENEFGIASTLDSSQCVTEKKVLSIATITFTQF
VPEATEEEVNKMTSDVLAAMKKNSGNGCLENQLSVFLDEICHETELSNKYGLSGCCSQSG
VERHQCLLARKKTASASVPPFQFPEPAESCKAHEENRTAFMKSFIYEVSRRNVFMYSPAI
LSLAAQYDNIVPVCCKADNMEECFQTKRASLAKELREGSMLNEHVCTVNRKFGSRNLQAM
TIIKLSQKFPEANFTEIRKLALDVAHIHEECCHGNALECLQDGEKAMTYICSHQNILSSK
IAECCKLPIIQLGFCIIHAENGVKPEGLSLNPSQFLGERNFAQLSSKEKIMFMASFLHGY
SRTHPNLPVSVILRIANKYQESLEKCSQSGNLPGCQDNLEEEFQKQIEESQALAKQSCAL
YQTLGDHKLQTLFLIGYTRKAPQLTSAELIDLTRKMVSIAATCCQLSEEKWSGCGEGMAD
IFIGHLCIRNEASPVNSGISHCCNSSYSNRRPCITSFLKDKAYIPPQFSEDKFIFHKDLC
QAQGEALQTMKQELLINLVRQKPELTEEQFAVITADFSGFLDKCCKVQDREVCFAEEGPK
LISKTRAALGV
NT seq 1836 nt   +upstreamnt  +downstreamnt
atgaagcaaccagcagccatgaagtggagcatacctgcttccctcatcctcctgctacat
ttcgctggatccatagcacggcacgaaaatgagtttgggatagcttccacattagattct
tcccagtgcgtgacagagaagaaggtgcttagcatagctaccatcacctttacccagttt
gttccggaagccactgaggaggaagtgaacaaaatgactagcgacgtgttggcagcaatg
aagaaaaactctggcaacgggtgtttagaaaaccagctatctgtgtttctggatgaaatt
tgccatgagacggaactctctaacaagtatggactctcaggctgctgcagccaaagtggg
gtggaaagacaccagtgtctgctggcgcgtaagaagactgcttcggcctctgtcccaccc
ttccagtttccagaacctgctgagagttgcaaagcacatgaagaaaacaggacggcgttc
atgaaatcgtttatctacgaagtgtccaggaggaatgtcttcatgtattcccctgccatt
ctgtccttggctgctcagtatgacaacatagttccagtgtgctgcaaagctgacaacatg
gaggagtgcttccagacaaagagagcatcacttgcaaaggaattaagagaaggaagcatg
ttaaatgagcatgtatgtacagtgaatagaaaatttggatcccgaaacctccaggctatg
accattattaagctaagtcaaaagtttcctgaagcaaattttactgagattcggaagctg
gccctggacgtggctcacatccacgaggagtgttgccatggaaacgcgctggagtgtctg
caggatggggaaaaagccatgacatatatatgttctcatcaaaatattctgtcaagcaaa
atagcagagtgctgcaaattacccataatccaactcggcttctgcataattcacgcagaa
aatggcgtcaaacctgaaggtttatctttaaatccaagccagtttttgggagagagaaat
tttgcccaactttcttcaaaggaaaaaatcatgttcatggcaagctttcttcacggatat
tcaagaactcaccccaaccttcctgtctcagtcattctaagaattgctaacaaataccag
gaatcattggagaagtgttcccagtctggaaatctacctggatgtcaggacaatctggaa
gaagaatttcagaaacagatcgaggagagccaggcgttggccaaacaaagctgtgctctc
taccagacgttaggagaccacaaattacaaactctgttcctcattggttacacgaggaaa
gcccctcagctgacctcagcggagctgattgacctcaccaggaagatggtgagcattgcc
gccacgtgctgccagctcagtgaggagaaatggtctggctgtggtgagggaatggccgac
attttcattggacacttgtgtataaggaatgaagcaagccctgtgaactctggtatcagc
cactgctgcaactcttcgtattccaacaggaggccatgcatcaccagttttctgaaggat
aaagcttatatccctccccaattctctgaggataaattcatcttccacaaggatctgtgc
caagctcagggcgaagccctacagaccatgaaacaagagcttctcattaacctggtgagg
caaaagcctgaactgacagaggagcagttcgcggtcatcactgcagatttctcgggcttt
ttggataagtgctgcaaagtccaggaccgtgaagtctgtttcgcagaagagggtccaaag
ttgatttccaaaactcgtgctgctttgggcgtttaa

DBGET integrated database retrieval system