KEGG   Mus pahari (shrew mouse): 110331028
Entry
110331028         CDS       T05929                                 

Gene name
Pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah04010  MAPK signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04020  Calcium signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04144  Endocytosis
mpah04151  PI3K-Akt signaling pathway
mpah04510  Focal adhesion
mpah04540  Gap junction
mpah04630  JAK-STAT signaling pathway
mpah04810  Regulation of actin cytoskeleton
mpah05163  Human cytomegalovirus infection
mpah05200  Pathways in cancer
mpah05206  MicroRNAs in cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05218  Melanoma
mpah05230  Central carbon metabolism in cancer
mpah05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110331028 (Pdgfra)
   04014 Ras signaling pathway
    110331028 (Pdgfra)
   04015 Rap1 signaling pathway
    110331028 (Pdgfra)
   04630 JAK-STAT signaling pathway
    110331028 (Pdgfra)
   04020 Calcium signaling pathway
    110331028 (Pdgfra)
   04072 Phospholipase D signaling pathway
    110331028 (Pdgfra)
   04151 PI3K-Akt signaling pathway
    110331028 (Pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110331028 (Pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110331028 (Pdgfra)
   04540 Gap junction
    110331028 (Pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110331028 (Pdgfra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110331028 (Pdgfra)
   05206 MicroRNAs in cancer
    110331028 (Pdgfra)
   05230 Central carbon metabolism in cancer
    110331028 (Pdgfra)
   05231 Choline metabolism in cancer
    110331028 (Pdgfra)
  09162 Cancer: specific types
   05214 Glioma
    110331028 (Pdgfra)
   05218 Melanoma
    110331028 (Pdgfra)
   05215 Prostate cancer
    110331028 (Pdgfra)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110331028 (Pdgfra)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110331028 (Pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110331028 (Pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110331028 (Pdgfra)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110331028 (Pdgfra)
Protein kinases [BR:mpah01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   110331028 (Pdgfra)
CD molecules [BR:mpah04090]
 Proteins
  110331028 (Pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE C2-set_2 LAT Kinase-like C1-set
Other DBs
NCBI-GeneID: 110331028
NCBI-ProteinID: XP_021067003
Ensembl: MGP_PahariEiJ_G0017089
LinkDB
Position
13
AA seq 1089 aa
MGTSHGVFLVLSCLLTGPGLIFCQLLLPSILPNENERIVQLNSSFSLRCLGESEVSWQHP
MSEEEDPNVEIRNEENNSGLFVTVLEVVNASAAHTGWYTCYYNHTQTDESEIEGRHIYIY
VPDPDMAFVPLGMTDSLVIVEEDDSAIIPCRTTDPETQVTLHNNGRLVLASYDSRQGFNG
TFSVGPYVCEATVKGRTFKTSEFNVYALKATSELNLEMDTRQTVYKAGETIVVTCAVFNN
EVVDLQWTYPGEVRNKGITMLEEIKLPSIKLVYTLTVPKATVKDSGEYECAARQATKEVK
EMKRVTISVHEKGFVEIKPTFGQLEAVNLHEVREFVVEVQAYPTPRISWLKDNLTLIENL
TEITTDVQKSQETRYESKLKLIRAKEEDSGHYTIIVQNDDDVKSYTFELSTLVPASILEL
VDDHHGSGGGQTVRCIAEGTPLPDINWMICKDIKKCNNDTSWTVLASNVSNIITELPRRS
RSTVEGRVSFAKVEETIAVRCMAKNNHSFVTRELKLVAPTLRSELTVAAAVLVLLVIVIV
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFMSQHPEKSKKDLDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRPLYDRPASYKKKSMLDSEVKN
LLSDDDSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVQCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKVHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacctcccacggggtctttctggtcctcagctgtctcctcacagggccgggcctc
atcttctgccagctcctattaccctctatcctcccaaatgagaatgagaggattgtgcag
ctgaattcgtccttttctctgagatgccttggggagagtgaagtgagctggcagcacccc
atgtctgaagaagaggaccccaacgtggaaatcaggaatgaggaaaacaacagtggcctc
tttgtcacagtgctggaagtggtcaacgcctccgcagcccacaccggatggtacacttgc
tactacaaccacactcagaccgatgagagtgagatcgagggcaggcacatttatatctat
gtaccagacccagacatggcctttgtgcctctcgggatgacagattctttagtcatcgtg
gaagaggatgattctgccatcataccttgtcgcaccacagatccggagactcaagtcacc
ttgcacaataacgggaggctggtgcttgcctcctatgacagcaggcagggcttcaacggg
accttcagcgtggggccttacgtctgtgaggccaccgtcaaagggaggacgttcaagacc
agcgagtttaacgtttacgccttgaaagcaacgtcagaactgaatctggagatggacaca
cgacagaccgtgtataaggcaggagaaacgatcgtggtgacctgtgccgtctttaacaat
gaggtcgttgatctgcagtggacttaccccggagaagtgagaaacaaaggcatcaccatg
ttggaggagatcaaactcccatccatcaaactggtgtacactttgactgtccccaaggcc
acggtgaaggacagcggagagtatgaatgcgctgcccgtcaggccacgaaagaggtcaag
gaaatgaagagagtcaccatttctgtccacgagaaaggcttcgtggagatcaagcccacc
tttggccagctggaagctgtcaacttgcatgaagtcagagaatttgtggtggaggtgcag
gcctacccgacacccaggatatcgtggctgaaggacaacttgactctaatagagaatctc
accgagatcaccaccgacgtacagaagagccaggaaacaaggtatgaaagcaaattaaag
ctgattcgcgctaaggaagaagacagtggccattacaccattatagttcaaaatgacgat
gacgtgaagagttacacgtttgagctgtcaactctagttcctgcgtccattctggagctc
gtagatgaccaccatggctctggcgggggacagactgtgaggtgcatagctgaaggcacc
cctcttccggacatcaactggatgatctgcaaggatattaagaaatgtaataatgatact
tcatggaccgttttggccagcaatgtctcgaatattatcacagagctccctcgccgcagc
aggagtaccgtggagggacgagtgtccttcgccaaagtggaagaaaccatcgcagttcga
tgcatggcaaagaacaaccacagctttgtgacccgggaactgaagctggtggctcccacc
ctgcgatctgaactcacagtggcggccgcagtgctggtgctgttggtgattgtcattgtc
tctctcatcgtcctggtggtcatttggaagcagaaaccacggtatgaaattcgctggagg
gtcatcgagtcgatcagccccgacggacatgagtatatctatgtggaccccatgcagttg
ccttacgactccagatgggaattcccaagagatggcctagtgcttggtcggattttggga
tccggtgcatttgggaaagtggttgaaggcacagcttatggattaagccggtcccagcct
gtaatgaaggtggctgtgaagatgctcaaacccacagccaggtctagtgaaaagcaagct
ctcatgtccgagctgaagataatgactcacttggggccgcatttgaacattgtgaacttg
ctgggagcctgcaccaagtcaggccccatttacatcatcacagaatactgtttctatggg
gacttggtcaactacttgcataagaacagagatagcttcatgagccaacacccagaaaag
tcaaagaaagacctggacatctttggattgaatcctgcagacgagagcacaagaagttat
gtgattttgtcttttgaaaataatggcgactacatggacatgaagcaagccgacaccaca
cagtatgtccccatgcttgaaaggaaagaggtttctaagtactctgacatccagagaccg
ctgtacgatcggccggcctcctacaagaagaaatccatgctagactcagaagtaaaaaac
ctcctttctgacgatgactccgagggtctgactttgctggatctattgagcttcacctat
caagttgcccgagggatggaatttttggcttcaaaaaattgtgtccaccgggacctggct
gcccgcaacgttctcctggcgcaagggaaaattgtgaagatctgtgactttggcctggcc
agagacatcatgcacgattccaactacgtgtcaaaaggcagtactttcctgcctgtgaag
tggatggcacccgagagcatcttcgacaacctctacaccacgctgagtgacgtctggtcc
tatggcattctgctctgggaaatcttttcccttggtggcacaccctatcctggcatgatg
gttgattctactttctacaataagatcaagagtggataccggatggccaaacctgaccat
gccaccagtgaagtctacgagatcatggtgcagtgctggaacagtgagcccgagaagaga
ccctccttttaccacctcagcgagatagtggagaatctgctgcctggacaatacaagaag
agttatgaaaaggttcacctggacttcctaaagagtgaccatccggctgtggcacgcatg
cgcgtggactctgataacgcgtacatcggtgtcacttacaaaaatgaagaggacaagctg
aaggactgggaagggggcctggacgaacagagactgagcgcagacagcggctacatcatc
cccctgccagacattgaccctgttccagaggaggaagacctgggcaagaggaacagacac
agctcacagacttcggaagagagtgccatcgagacaggttccagtagttccaccttcatc
aagagagaagatgagaccatcgaggacatcgacatgatggatgacattggtatagattcc
tcagacctggtggaggacagcttcctgtaa

DBGET integrated database retrieval system