KEGG   Mus pahari (shrew mouse): 110331061
Entry
110331061         CDS       T05929                                 

Gene name
Fbxw11
Definition
(RefSeq) F-box/WD repeat-containing protein 11 isoform X1
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04114  Oocyte meiosis
mpah04120  Ubiquitin mediated proteolysis
mpah04218  Cellular senescence
mpah04310  Wnt signaling pathway
mpah04340  Hedgehog signaling pathway
mpah04390  Hippo signaling pathway
mpah04710  Circadian rhythm
mpah05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110331061 (Fbxw11)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110331061 (Fbxw11)
   04340 Hedgehog signaling pathway
    110331061 (Fbxw11)
   04390 Hippo signaling pathway
    110331061 (Fbxw11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110331061 (Fbxw11)
   04218 Cellular senescence
    110331061 (Fbxw11)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    110331061 (Fbxw11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110331061 (Fbxw11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110331061 (Fbxw11)
   03036 Chromosome and associated proteins [BR:mpah03036]
    110331061 (Fbxw11)
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     110331061 (Fbxw11)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     110331061 (Fbxw11)
SSDB
Motif
Pfam: WD40 Beta-TrCP_D ANAPC4_WD40 F-box-like WD40_like F-box Nup160 Frtz DUF1513 DUF4508
Other DBs
NCBI-GeneID: 110331061
NCBI-ProteinID: XP_021067066
Ensembl: MGP_PahariEiJ_G0017325
LinkDB
Position
14
AA seq 563 aa
MEPDSVIEDKTIELMCSVPRSLWLGCANLVESMCALSCLQSMPSVRCLQNTSVMEDQNED
ESPKKSALWQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSESDQVEFVEHLISRM
CHYQHGHINSYLKPMLQRDFITALPEQGLDHIAENILSYLDARSLCAAELVCKEWQRVIS
EGMLWKKLIERMVRTDPLWKGLSERRGWDQYLFKNRPTDGPPNSFYRSLYPKIIQDIETI
ESNWRCGRHNLQRIQCRSENSKGVYCLQYDDDKIISGLRDNSIKIWDKSSLECLKVLTGH
TGSVLCLQYDERVIVTGSSDSTVRVWDVNSGEVLNTLIHHNEAVLHLRFSNGLMVTCSKD
RSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTL
NGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSG
AYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDF
LNVPPSAQNETRSPSRTYTYISR
NT seq 1692 nt   +upstreamnt  +downstreamnt
atggagcccgactcggtgattgaagacaagaccatcgagctcatgtgttctgtgccaagg
tctttgtggctaggctgcgccaacctggtagagagcatgtgcgcactgagttgcctgcag
agcatgcccagtgtcagatgtctccagaacacttcagttatggaagatcaaaatgaagat
gagtccccaaagaaaagtgctctttggcagataagtaatggaacatcatctgtgattgtc
tccagaaagaggccatcagaggggaactaccagaaagaaaaggacttgtgcattaagtac
tttgaccagtggtctgaatcagatcaggtggaatttgtggagcatcttatctcacggatg
tgtcattatcagcatggacatattaactcttacctgaagcccatgttgcagcgggacttt
atcaccgctttaccagagcaaggcttagatcacatagcagaaaacattctttcctacctg
gatgccaggtctctgtgtgcagcagagctggtgtgtaaagaatggcagcgagtgatctca
gaagggatgctttggaagaagctgattgagaggatggtgcgcactgaccctctctggaag
ggactctcagaaagaagaggctgggatcagtacctgtttaaaaacagacctacagatggc
cctcccaactcattttatagatcattatacccaaagattatccaggacatagagaccata
gaatccaactggcggtgtggacgacacaacttgcagaggatccagtgccgctctgaaaat
agtaagggtgtctactgtttgcaatatgatgatgataaaatcatcagtggcctccgggac
aactctatcaagatctgggataaaagcagcttggagtgtttgaaagtgctgacgggccac
acaggctctgtcctctgcctccagtacgacgagcgggtcatcgtgactgggtcttcagac
tccacggtgagagtctgggatgtgaactctggtgaagtgctcaacacactcatccaccac
aatgaagccgtactgcacttacgattcagcaatggactgatggtgacttgttccaaggac
cgttccatcgcggtgtgggacatggcttctgccaccgatatcactttacgccgtgttctg
gttggccaccgtgctgctgtcaatgtagtagactttgatgataagtacatcgtgtctgcc
tctggagacaggaccattaaagtgtggagcacgagcacctgtgagtttgttcgaactctg
aacgggcacaagcgaggtatcgcctgtctgcagtaccgggaccggctggttgttagtgga
tcatcagataataccatccggttatgggatattgaatgtggtgcctgtttaagagtccta
gaggggcacgaagaattggtccggtgcatccgttttgataacaagaggattgtcagtggc
gcctatgatgggaagattaaagtctgggacttgcaggctgctcttgaccctcgggcccca
gcaagcacattgtgcctgcgcaccttggtggaacactctggacgcgtgtttcggctgcag
tttgatgagtttcagatcatcagtagctcccacgatgacactattttgatttgggatttc
ttaaatgtgcctcccagtgcccagaatgagacccgctctccctccagaacctacacctat
atctccagatag

KEGG   Mus pahari (shrew mouse): 110337956
Entry
110337956         CDS       T05929                                 

Gene name
Btrc
Definition
(RefSeq) F-box/WD repeat-containing protein 1A isoform X1
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04114  Oocyte meiosis
mpah04120  Ubiquitin mediated proteolysis
mpah04218  Cellular senescence
mpah04310  Wnt signaling pathway
mpah04340  Hedgehog signaling pathway
mpah04390  Hippo signaling pathway
mpah04710  Circadian rhythm
mpah05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110337956 (Btrc)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110337956 (Btrc)
   04340 Hedgehog signaling pathway
    110337956 (Btrc)
   04390 Hippo signaling pathway
    110337956 (Btrc)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110337956 (Btrc)
   04218 Cellular senescence
    110337956 (Btrc)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    110337956 (Btrc)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110337956 (Btrc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110337956 (Btrc)
   03036 Chromosome and associated proteins [BR:mpah03036]
    110337956 (Btrc)
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     110337956 (Btrc)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     110337956 (Btrc)
SSDB
Motif
Pfam: WD40 Beta-TrCP_D F-box-like ANAPC4_WD40 F-box WD40_like Nup160 F-box_5 Frtz DUF4508 DUF6188
Other DBs
NCBI-GeneID: 110337956
NCBI-ProteinID: XP_021076767
Ensembl: MGP_PahariEiJ_G0014505
LinkDB
Position
1
AA seq 569 aa
MDPAEAVLQEKALKFMNSSEREDCNNGEPPRKIIPEKNSLRQTYNSCARLCINQETVCLT
STAMKTENCVAKTKLANGTSSMIVPKQRKLSASYEKEKELCVKYFEQWSESDQVEFVEHL
ISQMCHYQHGHINSYLKPMLQRDFITALPARGLDHIAESILSYLDAKSLCAAELVCKEWY
RVTSDGMLWKKLIERMVRTDSLWRGLAERRGWGQYLFKNKPPDENAPPNSFYRALYPKII
QDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDHKIVSGLRDNTIKIWDKNTLECR
RVLTGHTGSVLCLQYDDRVIVTGSSDSTVRVWDVNAGEMLNTLIHHCEAVLHLRFNNGMM
VTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTC
EFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDN
KRIVSGAYDGKIKVWDLMAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDT
ILIWDFLNDPAAHAEPPRSPSRTYTYISR
NT seq 1710 nt   +upstreamnt  +downstreamnt
atggacccggcagaggcggtgctgcaagagaaagcgcttaagtttatgaattcctcagag
agagaagactgtaataatggcgaaccccctaggaagataataccagagaagaattcactt
agacagacttacaacagctgtgccaggctttgcataaaccaagagacagtatgtctaaca
agcactgctatgaagactgaaaactgtgtggccaaaacaaaacttgccaatggcacttcc
agcatgattgtgcccaagcagcggaaactctcagcaagctatgagaaggaaaaggagctg
tgtgtcaagtattttgagcagtggtcagagtctgatcaagtggaatttgtagaacacctt
atatcccaaatgtgtcactatcagcatgggcacatcaactcctacttaaagcctatgctg
cagagggatttcataactgcactgccagcacggggtctggaccacattgctgagagcatt
ctgtcatacttggacgccaagtcactgtgtgctgctgagcttgtgtgcaaggaatggtac
cgtgtgacgtcggacggaatgttgtggaaaaagctcatcgagaggatggtcaggacagac
tctctgtggcgaggcctggcggagcgcagagggtggggacagtacttattcaaaaacaaa
cctcctgatgagaatgctcctcccaactccttctatagagcgctttaccctaaaatcata
caggacattgagacaattgagtccaattggagatgtgggcgacatagtttacagagaatc
cactgccggagtgaaacaagtaaaggggtttactgtttacagtatgacgaccacaagata
gtcagcggccttcgagacaacaccatcaagatctgggataaaaacaccctggaatgcagg
cgggtcctcacgggccacacgggctccgtcctgtgtctgcagtacgatgacagggtaatc
gtcacgggctcctcggactccaccgtcagagtgtgggatgtaaatgcaggtgaaatgcta
aacacattgattcaccactgtgaagccgttctgcacctgcgcttcaataatggcatgatg
gtaacctgctccaaagaccgttccatcgctgtgtgggatatggcttccccaactgacatc
accctcaggagggtgctggtgggacatcgagctgcggtcaatgttgtagactttgatgac
aagtacatcgtttctgcctctggagatagaaccataaaggtgtggaacacaagcacctgt
gaattcgtaaggaccctgaatgggcacaagcgtggcatcgcctgtttgcagtacagagac
aggctggtggtgagcggctcctctgacaataccatcaggctgtgggacatagagtgtgga
gcgtgtctgcgagtgttggaaggccatgaggagttggtacgctgcattcgatttgataac
aaaaggatagtgagcggagcctatgatgggaaaattaaagtgtgggatcttatggctgct
ttggacccacgtgctcctgcagggactctttgtctgcggacacttgtggagcattctgga
cgagttttccgcctccagtttgatgaattccagattgtcagtagttcacatgatgacaca
attctcatctgggacttcctgaacgatccagctgctcatgctgaaccgccccgctcccct
tctcggacatacacctacatctccagataa

DBGET integrated database retrieval system