KEGG   Mus pahari (shrew mouse): 110331174
Entry
110331174         CDS       T05929                                 

Gene name
Jup
Definition
(RefSeq) junction plakoglobin
  KO
K10056  junction plakoglobin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05221  Acute myeloid leukemia
mpah05226  Gastric cancer
mpah05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110331174 (Jup)
   05202 Transcriptional misregulation in cancer
    110331174 (Jup)
  09162 Cancer: specific types
   05226 Gastric cancer
    110331174 (Jup)
   05221 Acute myeloid leukemia
    110331174 (Jup)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110331174 (Jup)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110331174 (Jup)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110331174 (Jup)
SSDB
Motif
Pfam: Arm HEAT V-ATPase_H_N Cnd1 Adaptin_N HEAT_2 Atx10homo_assoc DUF3361 KAP Arm_2 PUL
Other DBs
NCBI-GeneID: 110331174
NCBI-ProteinID: XP_021067231
Ensembl: MGP_PahariEiJ_G0018299
LinkDB
Position
14
AA seq 745 aa
MEVMNLIEQPIKVTEWQQTYTYDSGIHSGVNTCVPSVSSKVIMDEDDACGRQYTLKKTTT
YTQGVPQSQGDLEYQMSTTARAKRVREAMCPGVSGEDSSLLLATQVEGQTTNLQRLAEPS
QLLKSAIVHLINYQDDAELATRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALM
GSPQLVAAVVRTMQNTSDLDTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVE
SVLFYAITTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQ
ESKLIILANGGPQGLVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQALGKH
LTSNSPRLVQNCLWTLRNLSDVATKQEGLESVLKILVNQLSVDDVNVLTCATGTLSNLTC
NNSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNY
GIPAIVKLLNQPNQWPLVKATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQR
HVAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLYSSVENI
QRVAAGVLCELAQDKEAADAIDAEGASAPLMELLHSRNEGTATYAAAVLFRISEDKNPDY
RKRVSVELTNSLFKHDPAAWEAAQSMIPINEPYADDMDATYRPMYSSDVPLDPLDMHMDL
DGDYPMDTYSDGLRPPYPTADHMLA
NT seq 2238 nt   +upstreamnt  +downstreamnt
atggaggtgatgaaccttattgagcagcccatcaaggtgacggagtggcagcagacatac
acctatgactcgggcatccactccggcgtcaatacctgcgtgccctctgtgagcagcaag
gtcatcatggatgaggacgacgcctgcggcagacagtacacactcaagaagacgaccacc
tatacacaaggggtgccacagagccaaggtgacctggagtaccagatgtccacgacggcc
agagccaagcgggtgcgggaggccatgtgtccaggggtctcaggcgaggacagttctcta
ctgctggccacccaggtggaggggcagacgaccaatctgcagcgcctggccgagccatcc
cagttgctcaagtcggccatcgtccatctcatcaactaccaggatgatgcagagctggcc
acccgggctctgcctgagctcaccaagctgctcaacgatgaggacccggtagtggtgacc
aaggcggctatgatcgtgaaccagctgtccaagaaggaagcgtcccgccgtgccctaatg
ggctcgccgcagctggtggcggcggtggtgcggaccatgcagaacaccagtgacctggat
acagcccggtgtaccaccagtatcctacacaacctctcccaccaccgagagggcttgctc
gccatcttcaagtctggaggcatccccgccctagtccgaatgctcagttcccccgtagag
tctgtcctgttctacgccatcaccaccttgcacaacctgctgctctatcaggagggcgcc
aagatggcggtgcgtctggcagatgggctgcagaagatggtgcccctactcaacaagaac
aaccctaagttcctggccatcaccacagactgcctgcagctcctggcctatggcaaccag
gagagcaagctgatcatcctggccaatgggggaccccaagggcttgtgcagatcatgagg
aactacagctacgagaagcttctgtggaccaccagccgtgtgctcaaggtgctctccgtg
tgtcctagcaacaagcctgccatcgtggaggctggtgggatgcaggctctgggcaagcac
ttgacaagcaacagccctcgcctggtgcagaactgcctgtggaccctgcgcaatctctca
gatgtggccaccaagcaggagggcctggagagtgtgctgaagatcctggtcaaccaactg
agtgtggatgacgtcaatgttctcacctgcgccacgggcaccctctccaacctgacctgc
aacaacagcaaaaacaagacgctggtgacgcagaacagtggcgtggaggcgctcatccac
gccatcctgagagccggagacaaagacgacatcacagagcccgctgtctgcgccctgcgc
caccttaccagccggcaccctgaggctgagatggcccagaactctgtgcgcctcaactat
ggaatcccggccattgtgaaactgctcaaccagccaaaccagtggccactggtcaaggca
actatcggcctgatccggaacctggctctgtgcccagccaaccatgcccctctgcaggag
gctgccgtcattccccgcctcgtccaactgttggtcaaggcccaccaggatgctcagcgc
catgtggctgcaggcacccagcagccttacacggatggtgtgaggatggaggagatagtg
gagggctgcaccggagccctgcacatccttgcccgggatcccatgaaccgcatggagatc
ttccggctcaacaccattcccctgtttgtccagctcctgtactcctctgtggagaacatc
cagcgtgtggctgcaggagtgctctgcgagctggcccaggacaaggaagctgccgatgcc
attgatgcagagggcgcctctgcccctctcatggaactgctccactcccgcaatgagggc
accgcaacctacgctgctgctgtcctgttccgcatctccgaggacaagaacccggattac
cgtaagcgagtgtccgtggagctcaccaactcgctcttcaagcatgacccagccgcctgg
gaggccgcccagagtatgatcccgatcaacgagccctacgcagacgacatggatgccacc
taccgccccatgtactccagcgatgtgcctctggatcctctggacatgcacatggacctg
gatggagactaccccatggacacctacagtgacggcctgaggcctccctaccccactgcg
gaccacatgctagcctag

DBGET integrated database retrieval system