KEGG   Mus pahari (shrew mouse): 110331237
Entry
110331237         CDS       T05929                                 

Gene name
Wwc1
Definition
(RefSeq) protein KIBRA isoform X1
  KO
K16685  protein KIBRA
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
mpah04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110331237 (Wwc1)
   04392 Hippo signaling pathway - multiple species
    110331237 (Wwc1)
SSDB
Motif
Pfam: WW C2 bZIP_Maf
Other DBs
NCBI-GeneID: 110331237
NCBI-ProteinID: XP_021067348
Ensembl: MGP_PahariEiJ_G0017345
LinkDB
Position
14
AA seq 1103 aa
MPRPELPLPEGWEEARDFDGKVYYIDHRNRTTSWIDPRDRYTKPLTFADCISDELPLGWE
EAYDPQVGDYFIDHNTKTTQIEDPRVQWRREQEHMLKDYLVVAQEALSAQKEIYQVKQQR
LELAQQEYQQLHAVWEHKLGSQVSLVSGSSSSSKYDPEILKAEIATAKSRVNKLKREMVH
LQHELQFKERGFQTLKRIDERMSDAQGGYKLDEAQAVLRETKAIKKAITCGEKEKQDLIK
SLAMLKDGFRTDRGSHSDLWSSSSSLESSSFPMPKQFLDVSSQTDISGSFSTSSNNQLAE
KVRLRLRYEEAKRRIANLKIQLAKLDSEAWPGVLDSERDRLILINEKEELLKEMRFISPR
KWTQGEVEQLEMARRRLEKDLQAARDTQSKALTERLKLNSKRNQLVRELEEATRQVATLH
SQLKSLSSSMQSLSSGSSPGSLTSSRGSLAASSLDSSTSASFTDLYYDPFEQLDSELQSK
VELLFLEGATGFRPSGCITTIHEDEVAKTQKAEGGSRLQALRSLSGTPRSMTSLSPRSSL
SSPSPPCSPLITDPLLTGDAFLAPLEFEDTELSATLCELNLGSGTRERYRLEEPGPEGKP
LGPAANVTPGCGLKVACVSAAVSDESVAGDSGVYEASAQRPGTSEAAAFDSDESEAVGAT
RVQIALKYDEKNKQFAILIIQLCNLSALSLQQDQKVNIRVAILPCSESGTCLFRTRPLDS
ADTLVFNEAFWVSISYPALHQKTLRVDVCTTDRSHTEECLGGAQISLAEVCRSGESSTRW
YNLLSYKYLKKECREPQPTEAPGPDHVDAVSALLEQTAVELEKRQEGRSSSQTLEGSWTY
EEETSENEAVAEEEEEGEEDVFTEKVSPEAEESPALKVDRETNTDNVAPSPTVVRPKDRR
VGAPSTGPFLRGNTIIRSKTFSPGPQSQYVCRLNRSDSDSSTLSKKPPFVRNSLERRSVR
MKRPSSVKSLRTERLIRTSLDLELDLQATRTWHSQLTQEISVLKELKEHLEQAKNHGEKE
LPQWLREDERFRLLLRMLEKRVDRGEHKSELRADKMMRAAAKDVHRLRGQSCKEPPEVQS
FREKMAFFTRPRMNIPALSADDV
NT seq 3312 nt   +upstreamnt  +downstreamnt
atgccccggccggagttgcccctgccggagggctgggaggaggcgcgcgacttcgacggc
aaggtctactacatagatcacaggaaccgcaccaccagctggatcgacccacgggacagg
tacaccaaacccctcaccttcgctgactgcattagtgatgagttgccgctgggatgggag
gaagcatacgatccacaggtcggagattacttcatagaccacaataccaaaaccactcag
atcgaggacccaagggtgcaatggcggcgggaacaggagcacatgctgaaggattacctg
gtggtggcccaggaagctctaagtgcacaaaaggagatctaccaggtgaagcagcagcgc
ctggagctggcacagcaggagtatcagcagttgcatgccgtctgggagcataagctgggc
tcccaggttagcttggtctctggatcctcgtccagctccaagtatgaccctgagatcctg
aaagctgaaattgccactgccaagtcccgggtcaacaagctgaagagagagatggttcac
ctgcagcatgagctgcagttcaaggagcgtggctttcagaccctgaagagaattgatgag
agaatgtcagatgctcagggtggctacaagctggatgaggcccaggctgtgctgagagaa
accaaagccatcaagaaagccatcacctgtggagagaaggagaagcaagacctcatcaag
agtctcgccatgctgaaagacggcttccggacagacagagggtcgcactccgacctctgg
tccagcagcagctctctggagagttcgagcttcccgatgccaaagcagttcctggacgtg
agctcgcagacagacatctccgggagtttcagcaccagcagcaacaatcagttggcggag
aaggtcagactgcgtcttcggtatgaagaggcgaagagaagaatcgccaacctcaagatc
cagctggccaaacttgacagtgaggcctggcctggggtgctagactcagagagggaccga
ctgatcctcatcaatgagaaagaggaacttctgaaggagatgcgcttcatcagcccccgg
aaatggacccagggagaggtggaacaactggagatggcccggagacgactggagaaggac
ttacaggcagcccgggacacccagagcaaggcgctgactgaaaggctgaagttaaacagc
aagaggaaccagctggtgcgggaactggaggaagccactcggcaggtggctaccctgcac
tcccagctgaaaagcctctcaagcagcatgcagtccctgtcttcaggcagtagccctggg
tcactcacctccagccggggctccctggctgcctctagcctggactcctccacctcagcc
agcttcactgacctctattacgacccgttcgagcagctggactcggagctccagagcaag
gtggagctgctgttcctggagggcgccacaggcttccggccctcaggctgcatcaccacc
atccatgaggatgaggtggccaagacccagaaggcagagggaggcagccgcctgcaggcc
ctgcgctccctatctggcactccaagatccatgacctccctgtctccacgctcatctctc
tcctccccatcccctccctgttcccctctcatcactgatcccctcctgactggagatgcc
tttctggccccgctggagtttgaagacacagagctgagtgccaccctttgtgagctgaac
ctcggcagcggcacccgggaaagataccggctggaggaaccgggacctgagggcaagccc
ctgggcccagctgcaaatgtgaccccgggatgtggcctcaaagtagcttgtgtgtctgct
gccgtgtccgatgagtcagtagccggggacagtggcgtgtatgaggcttcagcgcagaga
ccaggtacttctgaagctgccgcattcgacagtgatgaatcggaagctgtgggtgccact
cgggttcagatcgccctgaaatatgatgagaagaataagcaatttgcaatattaatcatt
cagctgtgtaacctgtctgctctgtcactacaacaagatcagaaagtgaacatccgtgta
gccatcctgccttgctctgaaagcggcacctgcctgttcagaacccggcctctggactct
gcagataccctcgtgttcaatgaggcattctgggtgtccatctcctacccagcccttcac
cagaagaccttacgagtcgatgtctgcaccactgacaggagccatacagaggagtgcctg
ggaggtgcccagatcagcctggccgaggtctgcagatctggggagagttcaacgcgctgg
tacaatctcctgagctacaaatacttgaagaaggagtgcagggagccccagccaacagaa
gctccagggccagaccacgtggatgctgtgtctgccttgctggaacagacagctgtggag
ctggagaagaggcaggaggggagaagcagctcccagacgctggaaggcagctggacgtac
gaggaagagaccagtgagaatgaggcagtcgctgaggaggaagaggagggagaggaagat
gtcttcactgaaaaggtctcccccgaggcagaggagagcccagcattaaaggtggacaga
gagaccaatactgacaacgtggccccgtcccccacagtggtgcgccccaaggaccggcgg
gtgggggccccctcgacagggccatttcttcgagggaataccatcatccgctccaagacc
ttctcgcctggaccccagagccagtacgtgtgtcggctgaaccgaagtgacagtgatagt
tctacgctgtccaagaagccaccttttgtgcgaaactccctggagcggcgcagtgtcagg
atgaagcggccttcctccgtcaagtccctgcgcacagagcgtctgatccgcacctcgctg
gacctagaactagacctgcaggccacgaggacctggcacagccaactgactcaggagatc
tcagtgttgaaggagctgaaggagcatttggagcaagccaagaaccacggggagaaggag
ctgccacagtggctgcgtgaagacgagcgcttccgcttgctactgaggatgctggagaag
agggtggatcgtggggagcacaagagcgagctgcgagcggacaagatgatgagagctgct
gccaaggatgtgcacaggcttcggggccagagctgtaaggagcccccagaagtgcagtct
ttcagggagaaaatggcatttttcacccggcctcggatgaacatcccagctctctctgca
gatgacgtctga

DBGET integrated database retrieval system