KEGG   Mus pahari (shrew mouse): 110331339
Entry
110331339         CDS       T05929                                 

Gene name
Erbb2
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-2
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah01524  Platinum drug resistance
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04020  Calcium signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04510  Focal adhesion
mpah04520  Adherens junction
mpah04530  Tight junction
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05212  Pancreatic cancer
mpah05213  Endometrial cancer
mpah05215  Prostate cancer
mpah05219  Bladder cancer
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05226  Gastric cancer
mpah05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110331339 (Erbb2)
   04012 ErbB signaling pathway
    110331339 (Erbb2)
   04066 HIF-1 signaling pathway
    110331339 (Erbb2)
   04020 Calcium signaling pathway
    110331339 (Erbb2)
   04151 PI3K-Akt signaling pathway
    110331339 (Erbb2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110331339 (Erbb2)
   04520 Adherens junction
    110331339 (Erbb2)
   04530 Tight junction
    110331339 (Erbb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110331339 (Erbb2)
   05206 MicroRNAs in cancer
    110331339 (Erbb2)
   05205 Proteoglycans in cancer
    110331339 (Erbb2)
   05230 Central carbon metabolism in cancer
    110331339 (Erbb2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110331339 (Erbb2)
   05226 Gastric cancer
    110331339 (Erbb2)
   05219 Bladder cancer
    110331339 (Erbb2)
   05215 Prostate cancer
    110331339 (Erbb2)
   05213 Endometrial cancer
    110331339 (Erbb2)
   05224 Breast cancer
    110331339 (Erbb2)
   05223 Non-small cell lung cancer
    110331339 (Erbb2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110331339 (Erbb2)
   01524 Platinum drug resistance
    110331339 (Erbb2)
   01522 Endocrine resistance
    110331339 (Erbb2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110331339 (Erbb2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110331339 (Erbb2)
   04090 CD molecules [BR:mpah04090]
    110331339 (Erbb2)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110331339 (Erbb2)
Protein kinases [BR:mpah01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   110331339 (Erbb2)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   110331339 (Erbb2)
CD molecules [BR:mpah04090]
 Proteins
  110331339 (Erbb2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like DUF5849 EphA2_TM
Other DBs
NCBI-GeneID: 110331339
NCBI-ProteinID: XP_021067486
Ensembl: MGP_PahariEiJ_G0018213
LinkDB
Position
14
AA seq 1255 aa
MELAAWCRWGFLLALLPPGAASTHVCTGTDMKLRFPASPETHLDMLRHLYQGCQVVQGNL
ELTYLPANASLSFLQDIQEVQGYMLIAHNRVRHIPLQRLRIVRGTQLFEDKYALAVLDNR
DPLDNVTAAPGRTPEGLRELRLRSLTEILKGGVLIRGNPQLCYQDMVLWKDVLRKNNQLA
PVDVDTNRSRACPPCAPTCKDNHCWGESPEDCQILTGTICTSGCARCKGRLPTDCCHEQC
AAGCTGPKHSDCLACLHFNHSGICELHCPALITYNTDTFESMLNPEGRYTFGASCVTTCP
YNYLSTEVGSCTLVCPPNNQEVTAEDGTQRCEKCSKPCAEVCYGLGMEHLRGARAITSDN
IQEFAGCKKIFGSLAFLPESFDGNPSSGIAPLKPEHLQVFETLEEITGYLYISAWPESLQ
DLSVFQNLRVIRGRILHDGAYSLTLQGLGIHSLGLRSLRELGSGLALIHRNTHLCFVHTV
PWDQLFRNPHQALLHSGNRPEEACGLEGLVCNSLCAHGYCWGPGPTQCVNCSQFLRGQEC
VEECRVWKGLPREYVSGKHCLPCHPECQPQNSSETCFGSEADQCAACAHYKDSSFCVARC
PSGVKPDLSYMPIWKYPDEEGICQPCPINCTHSCVDLDERGCPAEQRASPVTFIIATVVG
VLLFLIIVVVIGILIKRRRQKIRKYTMRRLLQETELVEPLTPSGAVPNQAQMRILKETEL
RKLKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSP
YVSRLLGICLTSTVQLVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSYLEDVR
LVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFT
HQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPVCTIDVYMIMVKCWM
IDSECRPRFRELVSEFSRMARDPQRFVVIQNEDLGPSSPMDSTFYRSLLEDDDMGELVDA
EEYLVPQQGFFSPDPAPGTGSTAHRRHRSSSARSGGGELTLGLEPSEEEPPRSPLAPSEG
AGSDVFDGDLAVGVTKGLQSLSPHDLSPLQRYSEDPTLPLPPETDGYVAPLACSPQPEYV
NQPEVRPQPPMTPEGPPPPVRPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLAPR
EGTASQPRPSPAFSPAFDNLYYWDQNSSEQGPPPSTFEGTPTAENPEYLGLDVPV
NT seq 3768 nt   +upstreamnt  +downstreamnt
atggagctggcggcctggtgccgttgggggttcctcctcgccctcctgccccccggagcc
gcgagtacccatgtgtgtaccggcacagacatgaagttgcggttccctgccagtcctgag
acccacctggacatgctccgccacctctaccagggctgtcaggtggtgcagggcaacttg
gaacttacgtacctgcccgccaatgccagcctctcgttcctgcaggacatccaggaagtc
cagggatacatgctcatcgctcacaaccgagtgaggcacatcccactgcagaggctgcgc
atcgtgagagggactcagctcttcgaggacaagtacgccctagctgtgctagacaaccga
gatcctttggacaacgtcaccgccgccccaggcagaaccccagaagggctgcgggagctg
cggctgcgaagtctcacagagatcctgaagggaggagttttgatccgtgggaacccgcag
ctctgctaccaggacatggttttgtggaaggatgtcctccgcaagaataaccagctggct
cctgtcgacgtagacaccaatcgttcccgggcctgtccaccttgcgccccaacttgcaaa
gacaatcactgttggggtgagagccctgaagactgtcagatcttgactggcaccatctgt
accagtggctgtgcccggtgcaagggccggctgcccactgactgttgccacgagcagtgt
gctgcaggctgcacgggccccaagcattctgactgcctggcctgcctccacttcaatcat
agtggtatctgtgagctgcactgcccggccctcatcacctacaacacagacaccttcgag
tccatgctcaaccctgagggccgctacacctttggtgccagctgtgtgaccacctgcccc
tacaactacctctccacggaagtgggatcctgcactctggtctgtcccccgaacaaccaa
gaggtcacagctgaggacgggacacagcggtgtgagaaatgcagcaagccctgtgctgaa
gtgtgctatggtttgggcatggagcacctccgaggggccagggccatcaccagtgacaat
atccaggagtttgctggctgcaagaagatctttgggagcctggcatttttgccggagagc
tttgatgggaacccctcctctggcattgccccactgaagccggagcatctccaagtgttc
gaaaccctggaggagatcacaggttacctatacatttcagcgtggccagagagcctccaa
gacctcagtgtcttccagaaccttcgggtcattcggggacggattctccatgatggtgct
tactcactgacgctgcaaggcctggggattcactcgctggggctgcgttcactgcgggag
ctgggcagtggattggctctcattcaccgcaacacccatctttgctttgtacacactgta
ccttgggaccagctcttccggaaccctcaccaggccctgctccacagcgggaaccggccg
gaagaggcgtgtggtcttgagggcttggtctgtaactcactgtgtgcccatgggtactgc
tgggggccagggcccacccagtgtgtcaactgcagtcagttcctccggggccaggagtgt
gtggaggagtgccgagtatggaaggggctccccagggagtatgtgagtggcaagcactgt
ctgccatgccaccccgagtgtcagcctcagaacagttccgagacctgctttggatcggag
gctgaccagtgtgcagcttgtgcccactacaaggactcatccttctgtgtggctcgctgc
cccagtggtgtgaaaccagacctctcctacatgcccatctggaagtacccggatgaggag
ggcatatgtcagccatgccccatcaactgcacccactcctgtgtggacctggacgaacga
ggctgcccggcagagcagagagccagcccggtgacattcatcattgcaactgtggtgggc
gtcctgttgttcctgatcatcgtggtagtcattggaatcctaatcaagcgaaggcgacag
aagatccggaagtataccatgcgtaggctgctgcaggagactgagctggtggagccgctg
acgcccagcggagcggtgcccaaccaggctcagatgcggatcctaaaggagacggagcta
aggaagctgaaggtgcttggatcaggagccttcggcactgtctacaagggcatctggatc
ccagatggggagaacgtgaaaatccccgtggccatcaaggtgttgagggaaaacacatct
cctaaagctaacaaagaaatcctagatgaagcctatgtcatggctggtgtgggttctccg
tatgtgtcccgtctcctgggcatctgcctgacatccacagtgcagctggtgacacagctt
atgccctatggctgccttctggaccatgtccgagaacatcgaggtcgcctaggctcccag
gacctgctcaactggtgtgttcagattgccaaggggatgagctacctggaggacgttcgg
cttgttcacagggacctagctgcccggaacgtgctagtcaagagtcccaaccacgtcaag
attactgacttcgggctggcccggctgctcgacattgatgagactgaataccatgcagat
gggggcaaggtgcccatcaagtggatggcattggaatctattctcagacgccggttcacc
catcagagtgatgtgtggagctatggtgtgactgtgtgggagctgatgacttttggggcc
aaaccttacgatgggatcccagcccgggagatccccgatttgctggagaagggagaacgc
ctacctcagcctccagtctgcaccatcgatgtctacatgatcatggtcaaatgttggatg
attgattccgaatgtcgcccgagattccgggagttagtatcagagttctcccgtatggcg
agggacccccagcgctttgtggtcatccagaacgaggacttgggcccttccagccccatg
gacagcactttctaccgttcactgctggaggatgatgacatgggggagctggtcgatgct
gaagagtacctggtaccccagcagggattcttctccccagaccctgccccaggtaccggg
agcacagcccaccgcagacaccgcagctcgtcggccaggagtggcggtggtgagctgacg
ctgggcctggagccctcggaagaagagccccccagatctccactggctccctccgaaggg
gctggctccgatgtgtttgatggtgacctggcagtgggggtaaccaaaggactgcagagc
ctctctccacatgacctcagccctctacagcggtacagtgaggatcccacattacctctg
ccccccgagactgatggctacgttgctcccctggcctgcagcccccagcccgagtatgtg
aaccagccagaggttcggcctcagcctcccatgaccccagagggtcctcctcctcctgtc
cgacctgccggtgctactctagaaagacccaagactctctctcctgggaagaatggggtt
gtcaaagacgtttttgcctttgggggtgctgtggagaaccctgaatacttagcacccaga
gaaggcactgcctctcagccccgcccttctcctgccttcagcccagcctttgacaatctc
tattactgggaccagaactcatcggagcaggggcctccaccaagtacctttgaagggacc
cccactgcagagaaccccgagtacctaggcctggatgtgccagtatga

DBGET integrated database retrieval system