KEGG   Mus pahari (shrew mouse): 110331408
Entry
110331408         CDS       T05929                                 

Gene name
Nos2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00220  Arginine biosynthesis
mpah00330  Arginine and proline metabolism
mpah01100  Metabolic pathways
mpah04020  Calcium signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04146  Peroxisome
mpah04371  Apelin signaling pathway
mpah04926  Relaxin signaling pathway
mpah05010  Alzheimer disease
mpah05014  Amyotrophic lateral sclerosis
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05133  Pertussis
mpah05140  Leishmaniasis
mpah05142  Chagas disease
mpah05145  Toxoplasmosis
mpah05146  Amoebiasis
mpah05152  Tuberculosis
mpah05200  Pathways in cancer
mpah05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    110331408 (Nos2)
   00330 Arginine and proline metabolism
    110331408 (Nos2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110331408 (Nos2)
   04066 HIF-1 signaling pathway
    110331408 (Nos2)
   04020 Calcium signaling pathway
    110331408 (Nos2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    110331408 (Nos2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    110331408 (Nos2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110331408 (Nos2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110331408 (Nos2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110331408 (Nos2)
   05014 Amyotrophic lateral sclerosis
    110331408 (Nos2)
   05022 Pathways of neurodegeneration - multiple diseases
    110331408 (Nos2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    110331408 (Nos2)
   05152 Tuberculosis
    110331408 (Nos2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110331408 (Nos2)
   05145 Toxoplasmosis
    110331408 (Nos2)
   05140 Leishmaniasis
    110331408 (Nos2)
   05142 Chagas disease
    110331408 (Nos2)
Enzymes [BR:mpah01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     110331408 (Nos2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 110331408
NCBI-ProteinID: XP_021067619
Ensembl: MGP_PahariEiJ_G0017955
LinkDB
Position
14
AA seq 1145 aa
MACPWKFLFKVKSYQGDLKEETDINNNVKKTPGAVLSPTIQDDPQSHQNGSPQLLTGTAQ
NVPESLDKLHVTPSTRPQYVRIKNWGSGEILHDTLHHKATSDFTCKSKSCLGSIMNPKSL
TRGPRDKPIPLEELLPQAIEFINQYYGSFKEAKIEEHLARLEAVTKEIETTGTYQLTLDE
LIFATKMAWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHILYATNNGNIRSAIT
VFPQRSDGKHDFRLWNSQLIRYAGYQMPDGTVRGDAATLEFTQLCIDLGWKPRYGRFDVL
PLVLQADGQDPEVFEIPPDLVLEVTMEHPKYEWFQELGLKWYALPAVANMLLEVGGLEFP
ACPFNGWYMGTEIGVRDFCDTQRYNILEEVGRRMGLETHKLASLWKDRAVTEINVAVLHS
FQKQNVTIMDHHTASESFMKHMQNEYRARGGCPADWIWLVPPVSGSITPVFHQEMLNYVL
SPFYYYQIEPWKTHNWQNEKLRPRRREIRFRVLVRVVFFASVLMRKVMASRVRATIIFAT
ETGKSEALARDLANLFSYAFNTKVVCMDQYKASTLEEEQLLLVVTSTFGNGDCPSNGQTL
KKSLFMLRELNHTFRYAVFGLGSSMYPQFCAFAHDIDQKLSHLGASQLAPTGEGDELSGQ
EDAFRSWAVQTFRAACETFDVRSKHHIQIPKRYTSNATWEPQQYRLTQSPEPLDLNRALS
SIHAKNVFTMRLKSQQNLQSEKSSRTTLLVQLTFEGSRGPSYLPGEHLGIFPGNQTTLVQ
GILERVVDCPTPHQTVCLEVLDESGSYWVKDKRLPPCSLSQALTYFLDITTPPTQLQLHK
LARLATDEADRQRLEALCQPAEYNDWKFSNNPTFLEVLEEFPSLRVPAAFLLSQLPILKP
RYYSISSSQDHTPSEVHLTVAVVTYRTRDGQGPLHHGVCSTWISNLKPQDPVPCFVRSVS
GFQLPEDPSQPCILVGPGTGIAPFRSFWQQRLHDSQHRGLKGGHMTLVFGCRHPEEDHLY
QEEMQEMVRKGVLFQVHTGYSRLPGKPKVYVQDILQKQLANKVLSVLHGEQGHLYVCGDV
RMARDVATTLKKLVATKLNLSEEQVEDYFFQLKSQKRYHEDIFGAVFSYGAKKGSALEEP
KGMRL
NT seq 3438 nt   +upstreamnt  +downstreamnt
atggcttgcccctggaagtttctcttcaaagtcaaatcctaccaaggtgacctgaaagag
gaaacggacatcaacaacaacgtgaagaaaaccccaggtgctgttctcagcccaacaata
caggatgaccctcagagtcaccaaaatggctccccccagctcctcaccggcacagcacag
aatgttccagaatccctggacaagctgcacgtgactccatcgacccgtccacagtatgtg
aggatcaaaaactggggcagcggagagattttgcatgacacgcttcaccacaaggccaca
tcggatttcacttgcaaatccaaatcttgcttggggtccatcatgaaccccaagagtttg
accagaggccccagagacaagcccatccctctggaggagctcctgcctcaagccatcgag
ttcatcaaccagtattacggctcctttaaagaggcaaaaatagaagaacatctggccagg
ctggaagctgtaacaaaggaaatagaaacaacaggaacctaccagctcactctggatgag
ctcatctttgccaccaagatggcctggaggaatgcccctcgctgcatcggcaggatccag
tggtccaacctgcaggtctttgatgctcggaactgtagcacagcacaggaaatgttccag
cacatctgtagacacatactttatgccaccaacaacggcaacatcaggtcggccatcact
gtgttcccccagcggagtgacggcaaacatgacttcaggctctggaattcacagctcatc
cggtacgccggctaccagatgcccgatggcaccgtcagaggggatgctgccaccttggag
ttcacccagttgtgcatcgacctgggctggaagccccgctatggccgcttcgatgtgctg
cctctggtcctgcaggctgacggtcaagatccagaggtctttgaaatccctcctgatctt
gtgttggaggtgaccatggagcatcccaagtacgagtggttccaggagcttgggctgaag
tggtatgcactgcctgccgtagccaacatgctactggaggtgggtggcctcgaattccca
gcctgccccttcaatggttggtacatgggcaccgagattggagttcgagacttctgtgac
acacagcgctacaacatcctggaggaagtgggcagaaggatgggcctggagacccacaaa
ctggcctccctctggaaagaccgggctgtcacggagatcaatgtggctgtactccatagt
ttccagaagcagaatgtgaccatcatggaccaccacacagcctcagagtccttcatgaag
cacatgcagaatgagtaccgggcccgaggaggctgcccggcagactggatttggctggtc
cctcctgtatccgggagcatcacccctgtgttccaccaggagatgttgaactatgtccta
tctccattctactactaccagatcgagccctggaagacccacaactggcagaatgagaag
ctgaggcccagaaggagagagatccgattcagagtcttggtgagagtggtgttctttgct
tccgtgctaatgcgaaaggtcatggcttcccgggttagagccacaatcatctttgctact
gagacggggaagtccgaagcactagccagggacctggccaacttgttcagctacgccttc
aacaccaaggttgtctgcatggaccagtataaggcaagcaccctggaagaggagcaacta
ctgctggtggtgacaagcacatttgggaatggagactgtcccagcaatgggcagactctg
aagaaatctctgttcatgctgagagaactcaaccacaccttcaggtatgctgtgtttggc
cttggctccagcatgtaccctcagttctgcgcctttgctcatgatatcgaccagaagctg
tcccacctgggagcctctcagctggccccaacaggagaaggggacgaactcagcgggcag
gaggatgccttccgcagctgggctgtacaaaccttccgggcagcctgtgagacctttgat
gttcgaagcaaacatcacattcagatcccgaaacgctacacttccaatgcaacatgggag
ccacagcaatataggctcacccagagcccagagcctttagacctcaacagagccctcagc
agcatccacgccaagaatgtgttcaccatgaggctgaaatcccagcagaatctgcagagt
gagaagtccagccgcaccaccctcctcgttcagctcaccttcgagggcagccgagggccc
agctacctgcctggggaacacctggggatcttcccaggcaaccagaccaccctggtgcag
ggaatcttggagcgagttgtggattgtcctacaccacaccaaactgtgtgcctggaggtt
ctggatgagagtggcagctactgggtcaaagacaagaggctgcccccctgctcactcagc
caagccctcacctacttcctggacatcacgacccctcccacccagctgcagctccacaag
ctggctcgccttgccacggatgaggctgacaggcagagattggaggccttgtgtcagccc
gcagagtacaatgactggaagttcagcaacaaccccacgttcctggaggtgctggaagag
ttcccttcgttgcgcgtgcctgctgctttcctgctgtcgcagctccctatcctgaagccc
cgctactactccatcagctcctcccaggaccacaccccctcggaggttcacctcactgtg
gctgtggtcacctaccgcacccgagatggtcagggtcccctgcaccacggtgtctgcagc
acctggatcagtaacctgaagccccaggacccagtgccctgctttgtgcgaagtgtcagt
ggcttccagctccccgaggacccctcccagccttgcatcctcgttgggcctggtacgggc
attgcccccttccgaagtttctggcagcagcggctccatgactcccagcacagagggctc
aaaggaggccacatgacattggtgtttggatgccggcacccagaggaggaccacctctat
caggaagaaatgcaggagatggtccgcaagggagtgctgttccaggtgcacacaggctac
tcccggctgcccggcaaacccaaggtctatgttcaggacatcctgcagaagcagctggct
aacaaggtactcagcgtgctccacggggagcagggccacctctacgtttgtggagatgtg
cgcatggcccgggatgtggctaccacgttgaagaagctggtggccaccaagctgaacttg
agtgaggagcaggtggaggactatttcttccagctcaagagccagaaacgttatcatgaa
gatatcttcggtgcagtcttttcctatggggcgaaaaagggcagcgccttggaggagccc
aaaggcatgaggctctga

DBGET integrated database retrieval system