KEGG   Mus pahari (shrew mouse): 110331730
Entry
110331730         CDS       T05929                                 

Gene name
Gfap
Definition
(RefSeq) glial fibrillary acidic protein isoform X1
  KO
K05640  glial fibrillary acidic protein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110331730 (Gfap)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110331730 (Gfap)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mpah04812]
    110331730 (Gfap)
Membrane trafficking [BR:mpah04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    110331730 (Gfap)
Cytoskeleton proteins [BR:mpah04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type III
     110331730 (Gfap)
SSDB
Motif
Pfam: Filament Filament_head DUF1664 Spc7 DUF4407 T6PP_N Snu56_snRNP GAS
Other DBs
NCBI-GeneID: 110331730
NCBI-ProteinID: XP_021068230
Ensembl: MGP_PahariEiJ_G0018396
LinkDB
Position
14
AA seq 430 aa
MERRRITSARRSYASSETVVRGLGPSRHPGTMPRFSLSRMTPPLPARVDFSLAGALNAGF
KETRVSERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAELRE
LRLQLDQLTANSARLEVERDNLAQDLGTLRQKLQDETNLRLEAENNLAAYRQEADEATLA
RVDLERKIESLEGEIQFLRKIHEEEVRELREQLARQQVHVEMDVAKPDLTAALREIRTQY
EAVATSNMQETEEWYRSKFADLTDAASRNAELLRQAKHEANDYRRQLQALTCDLESLRGT
NESLERQMREQEERHVRESASYQEALARLEEEGQSLKGEMARHLQEYQDLLNVKLALDIE
IATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIK
ESKQEHKDVM
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggagcggagacgcatcacctctgcgcgccgttcctatgcctcctctgagacagtggtc
aggggccttggtcctagtcgacacccgggtaccatgccacgcttctccctgtctcgaatg
actcctccactccctgccagggtggacttctccctggccggggcgctcaatgccggcttc
aaggagacccgggtgagcgagcgtgcagagatgatggagctcaatgaccgctttgctagc
tacatcgagaaggtccgcttcctggaacagcaaaacaaggcgctggcagccgagctgaac
cagcttcgagccaaggagcccaccaaactggctgatgtctaccaggcggagcttcgggag
ctgcggctgcagctggaccagctgacggccaacagtgcccggctggaggtggagagggac
aacctcgcacaggacctcggcaccctgaggcagaagctccaagatgaaaccaacctgagg
ctggaggcagagaacaacctggctgcatatagacaggaggcagatgaagccaccctggct
cgcgtggacctggagaggaagattgaatcgctggagggagagatccagttcttgaggaag
atccatgaggaggaagttcgagaactccgggaacagctggcccgacagcaggtccacgtg
gagatggatgtggccaagccagacctcacagcggccctgagagagattcgcactcaatac
gaggcagtggccaccagtaacatgcaagagacagaggagtggtatcggtctaagtttgca
gacctcacagacgctgcgtcccgcaacgcagagctgctccgccaggccaagcatgaagct
aacgactatcgccgccagctgcaggccttgacctgcgacctggagtccctgcgcggcacg
aacgagtccctggagaggcaaatgcgcgaacaggaagagcgccatgtgcgggagtcggcc
agttaccaggaggcactcgctcggctggaggaggagggccaaagcctcaagggggagatg
gcccgccacttgcaggagtaccaggatctactcaacgttaagctagccctggacatcgag
atcgccacctacaggaaattgctggagggcgaagaaaaccgcatcaccattcctgtacag
actttctccaacctccagatccgagaaaccagcctggacaccaaatccgtgtcagaaggc
cacctcaagaggaacatcgtggtaaagacggtggagatgcgggatggtgaggtcattaag
gagtcgaagcaggagcacaaggatgtgatgtga

DBGET integrated database retrieval system