KEGG   Mus pahari (shrew mouse): 110332414
Entry
110332414         CDS       T05929                                 

Gene name
Birc5
Definition
(RefSeq) baculoviral IAP repeat-containing protein 5
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01524  Platinum drug resistance
mpah04210  Apoptosis
mpah04215  Apoptosis - multiple species
mpah04390  Hippo signaling pathway
mpah05161  Hepatitis B
mpah05200  Pathways in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110332414 (Birc5)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110332414 (Birc5)
   04215 Apoptosis - multiple species
    110332414 (Birc5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110332414 (Birc5)
   05207 Chemical carcinogenesis - receptor activation
    110332414 (Birc5)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110332414 (Birc5)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110332414 (Birc5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110332414 (Birc5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110332414 (Birc5)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mpah03036]
    110332414 (Birc5)
Peptidases and inhibitors [BR:mpah01002]
 Peptidase inhibitors
  Family I32: IAP family
   110332414 (Birc5)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     110332414 (Birc5)
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    110332414 (Birc5)
SSDB
Motif
Pfam: BIR
Other DBs
NCBI-GeneID: 110332414
NCBI-ProteinID: XP_021069301
Ensembl: MGP_PahariEiJ_G0018600
LinkDB
Position
14
AA seq 142 aa
MGAPALPPTWQLYLKSHRIATFKNWPFLEDCACTPERMAEAGFIHCPTENEPDLAQCFFC
FKELEGWEPDDNPIEEHRKHSPGCAFLTVKKQMEELTVREFLKLDKQRAKNKIAKETNNK
QKEFEETAKTARQSIEQLAALR
NT seq 429 nt   +upstreamnt  +downstreamnt
atgggggctccggcgctgcccccgacctggcagctgtacctcaagagccaccgcatcgcc
accttcaagaactggcccttcctggaggactgcgcctgcaccccagagcggatggcggag
gctggcttcatccactgccctaccgagaacgagcctgacttggcccagtgttttttctgc
tttaaggaattggaaggctgggaacccgatgacaaccctatagaggagcatagaaagcac
tcgcctggctgtgccttcctcactgtcaagaagcagatggaagaactgaccgtcagagaa
tttctgaaactggacaaacagagagccaagaacaaaattgcaaaggagaccaacaacaag
caaaaagagtttgaagaaactgcaaagactgcccgtcagtcaattgagcagctggctgcc
ttgcgctga

DBGET integrated database retrieval system