KEGG   Mus pahari (shrew mouse): 110332438
Entry
110332438         CDS       T05929                                 

Gene name
Csf2
Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04630  JAK-STAT signaling pathway
mpah04640  Hematopoietic cell lineage
mpah04650  Natural killer cell mediated cytotoxicity
mpah04657  IL-17 signaling pathway
mpah04660  T cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04668  TNF signaling pathway
mpah05146  Amoebiasis
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05171  Coronavirus disease - COVID-19
mpah05202  Transcriptional misregulation in cancer
mpah05221  Acute myeloid leukemia
mpah05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110332438 (Csf2)
   04668 TNF signaling pathway
    110332438 (Csf2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110332438 (Csf2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110332438 (Csf2)
   04650 Natural killer cell mediated cytotoxicity
    110332438 (Csf2)
   04660 T cell receptor signaling pathway
    110332438 (Csf2)
   04657 IL-17 signaling pathway
    110332438 (Csf2)
   04664 Fc epsilon RI signaling pathway
    110332438 (Csf2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110332438 (Csf2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    110332438 (Csf2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    110332438 (Csf2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110332438 (Csf2)
   05171 Coronavirus disease - COVID-19
    110332438 (Csf2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110332438 (Csf2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110332438 (Csf2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mpah03019]
    110332438 (Csf2)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110332438 (Csf2)
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110332438 (Csf2)
Messenger RNA biogenesis [BR:mpah03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     110332438 (Csf2)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  CSF and other factors
   110332438 (Csf2)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Cytokines
   110332438 (Csf2)
SSDB
Motif
Pfam: GM_CSF DUF3937
Other DBs
NCBI-GeneID: 110332438
NCBI-ProteinID: XP_021069332
Ensembl: MGP_PahariEiJ_G0017489
LinkDB
Position
14
AA seq 141 aa
MWLQNLLFLGIVVYSLSAPTRSPITVTRPWKHVEAIKEALNLLDGTPVTLNEEVEVVSNE
FSFKRLTCVQTRLKIFEQGLRGNFVKLKGALNMTASYYQTYCPPTSESDCELQVTTFADF
IDSLKTFLTGIPLECEKTVRK
NT seq 426 nt   +upstreamnt  +downstreamnt
atgtggctgcagaatttacttttcctgggcattgtggtctacagcctctcagcacccacc
cgctcacccatcactgtcacccggccttggaagcatgtagaggccatcaaagaagccctg
aacctcctggatggcacgcctgtcacattgaacgaagaggtagaagttgtctctaacgag
ttctccttcaagaggctaacatgtgtgcagacccgcctgaagatattcgagcagggtcta
cggggcaattttgtcaaactcaagggcgccttgaacatgacagccagctactaccagacg
tactgccccccaacctcggaatctgactgtgaattacaagtcaccacctttgcggatttc
atagacagccttaaaacctttctgactggtatccccttagaatgcgaaaaaacagtccga
aaatga

DBGET integrated database retrieval system