KEGG   Mus pahari (shrew mouse): 110332758
Entry
110332758         CDS       T05929                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: interleukin-3-like
  KO
K04736  interleukin 3
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04210  Apoptosis
mpah04630  JAK-STAT signaling pathway
mpah04640  Hematopoietic cell lineage
mpah04664  Fc epsilon RI signaling pathway
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05221  Acute myeloid leukemia
mpah05310  Asthma
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110332758
   04151 PI3K-Akt signaling pathway
    110332758
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110332758
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110332758
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110332758
   04664 Fc epsilon RI signaling pathway
    110332758
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110332758
   05202 Transcriptional misregulation in cancer
    110332758
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    110332758
  09163 Immune disease
   05310 Asthma
    110332758
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110332758
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110332758
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interleukins
   110332758
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Haparin
  Cytokines
   110332758
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 110332758
NCBI-ProteinID: XP_021069762
Ensembl: MGP_PahariEiJ_G0017490
LinkDB
Position
14
AA seq 178 aa
MVLASSTTCIHSMLPLLLMLFHQGLQASISGQDTRHLTRPLNCSSIAKEIMGKLPVTSXF
FLSMSPQGSELNNTDQRAKLKDKTLRRVNLYKFLESQEKLDPNDKFGIKSNLQKLKCCLP
ASVNDSKLPGVLFQDLNDFQKKLRFYVVHLKNLQTVLTSRPPQPASGSVSLNPGVVEC
NT seq 537 nt   +upstreamnt  +downstreamnt
atggttcttgccagctctaccacctgcatccactccatgctgcccctgctcctgatgctc
ttccaccagggactccaagcttcaatcagtggccaggacacccgccatttaaccagacca
ttgaattgcagctctattgccaaggagattatggggaagctcccagtgacctcatgattc
tttctctctatgtccccacagggatctgaactcaataacactgatcaaagagccaagctg
aaggacaagaccttgcggagagtaaacctttacaaattcctggaaagccaagagaaattg
gatcctaacgataaattcggcatcaagtccaatcttcagaaacttaagtgttgcctgcct
gcatctgtgaatgactctaagctgccaggggtcttgtttcaagatctgaatgactttcag
aagaaattgagattctacgtggtccatcttaaaaatctgcagacagtgctaacctctaga
ccacctcagcccgcatctggctccgtctctcttaatcctggagtcgtggaatgttaa

DBGET integrated database retrieval system