KEGG   Mus pahari (shrew mouse): 110332760
Entry
110332760         CDS       T05929                                 

Gene name
Il4
Definition
(RefSeq) interleukin-4
  KO
K05430  interleukin 4
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04640  Hematopoietic cell lineage
mpah04657  IL-17 signaling pathway
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04660  T cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04672  Intestinal immune network for IgA production
mpah05140  Leishmaniasis
mpah05200  Pathways in cancer
mpah05310  Asthma
mpah05320  Autoimmune thyroid disease
mpah05321  Inflammatory bowel disease
mpah05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110332760 (Il4)
   04151 PI3K-Akt signaling pathway
    110332760 (Il4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110332760 (Il4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110332760 (Il4)
   04660 T cell receptor signaling pathway
    110332760 (Il4)
   04658 Th1 and Th2 cell differentiation
    110332760 (Il4)
   04659 Th17 cell differentiation
    110332760 (Il4)
   04657 IL-17 signaling pathway
    110332760 (Il4)
   04664 Fc epsilon RI signaling pathway
    110332760 (Il4)
   04672 Intestinal immune network for IgA production
    110332760 (Il4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110332760 (Il4)
  09163 Immune disease
   05310 Asthma
    110332760 (Il4)
   05320 Autoimmune thyroid disease
    110332760 (Il4)
   05321 Inflammatory bowel disease
    110332760 (Il4)
   05330 Allograft rejection
    110332760 (Il4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    110332760 (Il4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110332760 (Il4)
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110332760 (Il4)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interleukins
   110332760 (Il4)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Haparin
  Cytokines
   110332760 (Il4)
SSDB
Motif
Pfam: IL4 Rif1_N
Other DBs
NCBI-GeneID: 110332760
NCBI-ProteinID: XP_021069763
Ensembl: MGP_PahariEiJ_G0017476
LinkDB
Position
14
AA seq 142 aa
MGLRPQLAVILLFFLECTGNRIHGCNDKHLKEIINILNQVTGEGTPCLEMVVPDIFTARK
NTTESELICRASKVLRTFYLEHEILPCLKKNFSVLAQLQRLFRAMRCAKLPKSCTLNESA
LTSLKDFLESLKNIVQMDYSQY
NT seq 429 nt   +upstreamnt  +downstreamnt
atgggtctcaggccccagctagctgtcatcctgctcttctttctcgagtgtaccgggaac
cgtatccacggatgcaacgacaaacacttgaaagagatcatcaacattttgaaccaggtc
acaggagaagggacgccatgcctcgagatggtcgtgccagacatctttacagcaaggaag
aacaccacggagagcgagctcatctgtagggcttccaaggtgcttcgcacattttattta
gaacatgagatacttccgtgtttgaagaagaactttagtgttctcgcccagctgcagaga
ctctttcgggccatgagatgcgcgaagctaccgaaaagctgcaccctgaatgagtccgcg
ctcacatcattgaaagacttcctggaaagcctaaaaaacatcgtgcaaatggattactcg
cagtactga

DBGET integrated database retrieval system